1H, 13C, and 15N chemical shift assignments of the N-terminal fragment of PaaR2 regulator encoded on the cryptic prophage CP933-P in Escherichia coli O157:H7
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.0 % (722 of 914) | 76.9 % (373 of 485) | 81.6 % (284 of 348) | 80.2 % (65 of 81) |
Backbone | 84.6 % (369 of 436) | 81.9 % (122 of 149) | 86.6 % (188 of 217) | 84.3 % (59 of 70) |
Sidechain | 75.3 % (412 of 547) | 74.7 % (251 of 336) | 77.5 % (155 of 200) | 54.5 % (6 of 11) |
Aromatic | 52.3 % (46 of 88) | 52.3 % (23 of 44) | 51.2 % (22 of 43) | 100.0 % (1 of 1) |
Methyl | 100.0 % (46 of 46) | 100.0 % (23 of 23) | 100.0 % (23 of 23) |
1. entity 1
MQKKEIRRLR LKEWFKDKTL PPKEKSYLSQ LMSGRASFGE KAARRIEQTY GMPEGYLDAE YAEQPGSSHH HHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaaR2 N-terminal domain (residues 1-68) | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50711_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70---- MQKKEIRRLRLKEWFKDKTLPPKEKSYLSQLMSGRASFGEKAARRIEQTYGMPEGYLDAEYAEQPGSSHHHHHH |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| ..KKEIRRLRLKEWFKDKTL.PKEKSYLSQLMSGRASFGEKAARRIEQTYGMPEGYLDAEYAEQPGSS --------10--------20--------30--------40--------50--------60--------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 485 | 361 | 74.4 |
13C chemical shifts | 348 | 272 | 78.2 |
15N chemical shifts | 81 | 65 | 80.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 149 | 121 | 81.2 |
13C chemical shifts | 148 | 127 | 85.8 |
15N chemical shifts | 70 | 59 | 84.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 336 | 240 | 71.4 |
13C chemical shifts | 200 | 145 | 72.5 |
15N chemical shifts | 11 | 6 | 54.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 23 | 88.5 |
13C chemical shifts | 26 | 23 | 88.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 23 | 52.3 |
13C chemical shifts | 43 | 22 | 51.2 |
15N chemical shifts | 1 | 1 | 100.0 |