NMR resonance assignment of the golden kiwi fruit allergen Act c 8.0101
GVVTYDMEIP SKVPPVKLYK AFILDGDTLV PKVLPHAIKC VKILEGDGCA GTIKEVTFGE GSHHKCVKQR VDAIDKDNLT YSYTIIEGDV LAEKFESISY HIKIVACPDG GSICKNRSIY TTKGDCKVSE EEIKLGKEKA AEIFKALEAY LLANPDYC
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.2 % (1628 of 1826) | 87.5 % (826 of 944) | 89.9 % (652 of 725) | 95.5 % (150 of 157) |
Backbone | 94.8 % (885 of 934) | 93.5 % (300 of 321) | 95.5 % (441 of 462) | 95.4 % (144 of 151) |
Sidechain | 85.2 % (884 of 1038) | 84.4 % (526 of 623) | 86.1 % (352 of 409) | 100.0 % (6 of 6) |
Aromatic | 46.7 % (56 of 120) | 56.7 % (34 of 60) | 36.7 % (22 of 60) | |
Methyl | 92.3 % (179 of 194) | 90.7 % (88 of 97) | 93.8 % (91 of 97) |
1. entity 1
GVVTYDMEIP SKVPPVKLYK AFILDGDTLV PKVLPHAIKC VKILEGDGCA GTIKEVTFGE GSHHKCVKQR VDAIDKDNLT YSYTIIEGDV LAEKFESISY HIKIVACPDG GSICKNRSIY TTKGDCKVSE EEIKLGKEKA AEIFKALEAY LLANPDYCSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Act c 8.0101 | [U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Act c 8.0101 | [U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Act c 8.0101 | [U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Bruker AVANCE NEO - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Act c 8.0101 | [U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | Act c 8.0101 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
4 | sodium phosphate | natural abundance | 20 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50812_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISY |||||||| |||| ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||| GVVTYDME.PSKV.PVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEG.HHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISY -------110-------120-------130-------140-------150-------- HIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| HIKIVAC.DGGSICKNRSIYTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
69 | GLN | CD | 176.019 |
78 | ASN | CG | 177.276 |
116 | ASN | CG | 174.228 |
154 | ASN | CG | 177.972 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 944 | 823 | 87.2 |
13C chemical shifts | 725 | 649 | 89.5 |
15N chemical shifts | 157 | 151 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 302 | 94.1 |
13C chemical shifts | 316 | 301 | 95.3 |
15N chemical shifts | 151 | 145 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 623 | 521 | 83.6 |
13C chemical shifts | 409 | 348 | 85.1 |
15N chemical shifts | 6 | 6 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 98 | 83 | 84.7 |
13C chemical shifts | 98 | 87 | 88.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 34 | 56.7 |
13C chemical shifts | 60 | 22 | 36.7 |