1H, 15 N, and 13 C resonance assignments of the SH3-like tandem domain of human KIN17 protein
GEEEKKRTAR TDYWLQPEII VKIITKKLGE KYHKKKAIVK EVIDKYTAVV KMIDSGDKLK LDQTHLETVI PAPGKRILVL NGGYRGNEGT LESINEKTFS ATIVIETGPL KGRRVEGIQY EDISKLA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.9 % (1489 of 1536) | 96.6 % (777 of 804) | 98.0 % (584 of 596) | 94.1 % (128 of 136) |
Backbone | 97.6 % (736 of 754) | 97.3 % (254 of 261) | 97.6 % (361 of 370) | 98.4 % (121 of 123) |
Sidechain | 96.7 % (868 of 898) | 96.3 % (523 of 543) | 98.8 % (338 of 342) | 53.8 % (7 of 13) |
Aromatic | 100.0 % (70 of 70) | 100.0 % (35 of 35) | 100.0 % (34 of 34) | 100.0 % (1 of 1) |
Methyl | 97.6 % (160 of 164) | 97.6 % (80 of 82) | 97.6 % (80 of 82) |
1. entity 1
GEEEKKRTAR TDYWLQPEII VKIITKKLGE KYHKKKAIVK EVIDKYTAVV KMIDSGDKLK LDQTHLETVI PAPGKRILVL NGGYRGNEGT LESINEKTFS ATIVIETGPL KGRRVEGIQY EDISKLASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SH3 tandem domain of KIN protein | [U-13C; U-15N] | 0.35 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | EDTA | natural abundance | 3 mM | |
7 | DSS | natural abundance | 0.33 mM | |
8 | D2O | natural abundance | 5 % | |
9 | H2O | natural abundance | 95 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50957_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GEEEKKRTARTDYWLQPEIIVKIITKKLGEKYHKKKAIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGYRGNEGTLESINEKTFS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EEEKKRTARTDYWLQPEIIVKIITKKLGEKYHKKKAIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGYRGNEGTLESINEKTFS -------110-------120------- ATIVIETGPLKGRRVEGIQYEDISKLA ||||||||||||||||||||||||||| ATIVIETGPLKGRRVEGIQYEDISKLA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 804 | 790 | 98.3 |
13C chemical shifts | 596 | 587 | 98.5 |
15N chemical shifts | 136 | 127 | 93.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 261 | 256 | 98.1 |
13C chemical shifts | 254 | 246 | 96.9 |
15N chemical shifts | 123 | 120 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 543 | 534 | 98.3 |
13C chemical shifts | 342 | 341 | 99.7 |
15N chemical shifts | 13 | 7 | 53.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 82 | 98.8 |
13C chemical shifts | 83 | 82 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 35 | 100.0 |
13C chemical shifts | 34 | 34 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |