Backbone and Side Chain assignments of Peptide Deformylase complexed with Actinonin
SVLQVLHIPD ERLRKVAKPV EEVNAEIQRI VDDMFETMYA EEGIGLAATQ VDIHQRIIVI DVSENRDERL VLINPELLEK SGETGIEEGC LSIPEQRALV PRAEKVKIRA LDRDGKPFEL EADGLLAICI QHEMDHLVGK LFMDYLS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.3 % (1604 of 1719) | 94.6 % (849 of 897) | 90.6 % (609 of 672) | 97.3 % (146 of 150) |
Backbone | 96.9 % (843 of 870) | 98.0 % (290 of 296) | 96.1 % (416 of 433) | 97.2 % (137 of 141) |
Sidechain | 90.7 % (896 of 988) | 93.0 % (559 of 601) | 86.8 % (328 of 378) | 100.0 % (9 of 9) |
Aromatic | 21.0 % (13 of 62) | 41.9 % (13 of 31) | 0.0 % (0 of 31) | |
Methyl | 93.6 % (189 of 202) | 97.0 % (98 of 101) | 90.1 % (91 of 101) |
1. Peptide Deformylase
SVLQVLHIPD ERLRKVAKPV EEVNAEIQRI VDDMFETMYA EEGIGLAATQ VDIHQRIIVI DVSENRDERL VLINPELLEK SGETGIEEGC LSIPEQRALV PRAEKVKIRA LDRDGKPFEL EADGLLAICI QHEMDHLVGK LFMDYLSTemperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Bruker DMX - 600 MHz
State isotropic, Temperature 310 (±1) K, pH 7.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptide Deformylase | [U-95% 13C; U-90% 15N] | 0.5 ~ 1.2 mM | |
2 | TRIS | 20 mM | ||
3 | NaN3 | 0.02 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr5404_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALV -------110-------120-------130-------140------- PRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS ||||||||||||||||||||||||||||||||||||||||||||||| PRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
4 | GLN | CD | 180.379 |
24 | ASN | CG | 175.962 |
28 | GLN | CD | 179.422 |
37 | THR | HG1 | 5.45 |
49 | THR | HG1 | 6.57 |
50 | GLN | CD | 176.368 |
55 | GLN | CD | 177.929 |
65 | ASN | CG | 177.304 |
74 | ASN | CG | 177.414 |
92 | SER | HG | 5.812 |
96 | GLN | CD | 179.162 |
131 | GLN | CD | 179.926 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 160 | 149 | 93.1 |
1H chemical shifts | 897 | 844 | 94.1 |
13C chemical shifts | 672 | 609 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 141 | 140 | 99.3 |
1H chemical shifts | 296 | 294 | 99.3 |
13C chemical shifts | 294 | 282 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 19 | 9 | 47.4 |
1H chemical shifts | 601 | 550 | 91.5 |
13C chemical shifts | 378 | 327 | 86.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 105 | 99 | 94.3 |
13C chemical shifts | 105 | 92 | 87.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 11 | 35.5 |
13C chemical shifts | 31 | 0 | 0.0 |