Sequence-specific 1H, 13C and 15N resonance assignments of SAM22, an allergenic stress-induced protein from soy bean
GVFTFEDEIN SPVAPATLYK ALVTDADNVI PKALDSFKSV ENVEGNGGPG TIKKITFLED GETKFVLHKI ESIDEANLGY SYSVVGGAAL PDTAEKITFD SKLVAGPNGG SAGKLTVKYE TKGDAEPNQD ELKTGKAKAD ALFKAIEAYL LAHPDYN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.0 % (1644 of 1749) | 96.4 % (866 of 898) | 89.8 % (622 of 693) | 98.7 % (156 of 158) |
Backbone | 97.1 % (899 of 926) | 96.6 % (310 of 321) | 96.9 % (442 of 456) | 98.7 % (147 of 149) |
Sidechain | 90.7 % (875 of 965) | 95.3 % (550 of 577) | 83.4 % (316 of 379) | 100.0 % (9 of 9) |
Aromatic | 50.8 % (64 of 126) | 93.7 % (59 of 63) | 7.9 % (5 of 63) | |
Methyl | 100.0 % (186 of 186) | 100.0 % (93 of 93) | 100.0 % (93 of 93) |
1. SAM22
GVFTFEDEIN SPVAPATLYK ALVTDADNVI PKALDSFKSV ENVEGNGGPG TIKKITFLED GETKFVLHKI ESIDEANLGY SYSVVGGAAL PDTAEKITFD SKLVAGPNGG SAGKLTVKYE TKGDAEPNQD ELKTGKAKAD ALFKAIEAYL LAHPDYNTemperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Temperature 298 (±1) K, pH 7.0 (±0.2)
List #1 J_values_set_1
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
#1 Model Bruker DRX (600 MHz)
#2 Model Bruker DMX (750 MHz)
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SAM22 | [U-99% 15N] | 1.5 mM |
Temperature 298 (±1) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | SAM22 | [U-99% 13C; U-99% 15N] | 0.7 ~ 1.5 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr5605_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFD -------110-------120-------130-------140-------150------- SKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
10 | ASN | CG | 177.32 |
28 | ASN | CG | 176.64 |
42 | ASN | CG | 175.43 |
46 | ASN | CG | 177.86 |
51 | THR | HG1 | 6.37 |
77 | ASN | CG | 177.81 |
108 | ASN | CG | 178.24 |
128 | ASN | CG | 176.28 |
129 | GLN | CD | 179.95 |
157 | ASN | CG | 177.93 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 898 | 889 | 99.0 |
13C chemical shifts | 693 | 621 | 89.6 |
15N chemical shifts | 158 | 157 | 99.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 320 | 99.7 |
13C chemical shifts | 314 | 305 | 97.1 |
15N chemical shifts | 149 | 148 | 99.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 577 | 569 | 98.6 |
13C chemical shifts | 379 | 316 | 83.4 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 93 | 93 | 100.0 |
13C chemical shifts | 93 | 93 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 59 | 93.7 |
13C chemical shifts | 63 | 0 | 0.0 |