Resonance Assignments for the 21 kDa engineered fluorescein-binding lipocalin FluA
DVYHDGACPE VKPVDNFDWS QYHGKWWEVA KYPSPNGKYG KCGWAEYTPE GKSVKVSRYD VIHGKEYFME GTAYPVGDSK IGKIYHSRTV GGYTKKTVFN VLSTDNKNYI IGYSCRYDED KKGHWDHVWV LSRSMVLTGE AKTAVENYLI GSPVVDSQKL VYSDFSEAAC KVNNSNWSHP QFEK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.7 % (2071 of 2164) | 96.4 % (1081 of 1121) | 94.8 % (804 of 848) | 95.4 % (186 of 195) |
Backbone | 94.7 % (1030 of 1088) | 95.7 % (360 of 376) | 93.8 % (503 of 536) | 94.9 % (167 of 176) |
Sidechain | 96.8 % (1204 of 1244) | 96.8 % (721 of 745) | 96.7 % (464 of 480) | 100.0 % (19 of 19) |
Aromatic | 100.0 % (282 of 282) | 100.0 % (141 of 141) | 100.0 % (134 of 134) | 100.0 % (7 of 7) |
Methyl | 93.4 % (142 of 152) | 94.7 % (72 of 76) | 92.1 % (70 of 76) |
1. fluorescein-bind lipocalin
DVYHDGACPE VKPVDNFDWS QYHGKWWEVA KYPSPNGKYG KCGWAEYTPE GKSVKVSRYD VIHGKEYFME GTAYPVGDSK IGKIYHSRTV GGYTKKTVFN VLSTDNKNYI IGYSCRYDED KKGHWDHVWV LSRSMVLTGE AKTAVENYLI GSPVVDSQKL VYSDFSEAAC KVNNSNWSHP QFEKTemperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
#1 Model Varian INOVA (900 MHz)
#2 Model Varian INOVA (750 MHz)
#3 Model Varian INOVA (600 MHz)
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | fluorescein-bind lipocalin | [U-95% 13C; U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | fluorescein-bind lipocalin | [U-90% 15N] | 0.7 mM |
Temperature 298 (±1) K, pH 6.4 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | fluorescein-bind lipocalin | [U-50% 2H; U-90% 15N] | 0.7 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr5756_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 DVYHDGACPEVKPVDNFDWSQYHGKWWEVAKYPSPNGKYGKCGWAEYTPEGKSVKVSRYDVIHGKEYFMEGTAYPVGDSKIGKIYHSRTVGGYTKKTVFN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VYHDGACPEVKPVDNFDWSQYHGKWWEVAKYPSPNGKYGKCGWAEYTPEGKSVKVSRYDVIHGKEYFMEGTAYPVGDSKIGKIYHSRTVGGYTKKTVFN -------110-------120-------130-------140-------150-------160-------170-------180---- VLSTDNKNYIIGYSCRYDEDKKGHWDHVWVLSRSMVLTGEAKTAVENYLIGSPVVDSQKLVYSDFSEAACKVNNSNWSHPQFEK ||||||||||| ||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| VLSTDNKNYII.YSCRYDEDKKGHWDH.WVLSRSMVLTGEAKTAVENYLIGSPVVDSQKLVYSDFSEAACKVNNSNWSHPQFEK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
53 | SER | HG | 5.44 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 199 | 185 | 93.0 |
1H chemical shifts | 1121 | 1087 | 97.0 |
13C chemical shifts | 848 | 809 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 176 | 166 | 94.3 |
1H chemical shifts | 376 | 359 | 95.5 |
13C chemical shifts | 368 | 340 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 23 | 19 | 82.6 |
1H chemical shifts | 745 | 728 | 97.7 |
13C chemical shifts | 480 | 469 | 97.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 74 | 94.9 |
13C chemical shifts | 78 | 72 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 7 | 7 | 100.0 |
1H chemical shifts | 141 | 141 | 100.0 |
13C chemical shifts | 134 | 134 | 100.0 |