1H, 13C and 15N Resonance Assignments and Secondary Structure of Human Coactosin Like Protein D123N
MATKIDKEAC RAAYNLVRDD GSAVIWVTFK YDGSTIVPGE QGAEYQHFIQ QCTDDVRLFA FVRFTTGDAM SKRSKFALIT WIGENVSGLQ RAKTGTDKTL VKEVVQNFAK EFVISDRKEL EENFIKSELK KAGGANYDAQ TELEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.1 % (1492 of 1753) | 84.7 % (767 of 906) | 83.3 % (570 of 684) | 95.1 % (155 of 163) |
Backbone | 94.0 % (844 of 898) | 92.9 % (287 of 309) | 94.5 % (416 of 440) | 94.6 % (141 of 149) |
Sidechain | 78.4 % (780 of 995) | 80.4 % (480 of 597) | 74.5 % (286 of 384) | 100.0 % (14 of 14) |
Aromatic | 2.3 % (4 of 174) | 2.3 % (2 of 87) | 0.0 % (0 of 85) | 100.0 % (2 of 2) |
Methyl | 98.7 % (156 of 158) | 97.5 % (77 of 79) | 100.0 % (79 of 79) |
1. coactosin like protein
MATKIDKEAC RAAYNLVRDD GSAVIWVTFK YDGSTIVPGE QGAEYQHFIQ QCTDDVRLFA FVRFTTGDAM SKRSKFALIT WIGENVSGLQ RAKTGTDKTL VKEVVQNFAK EFVISDRKEL EENFIKSELK KAGGANYDAQ TELEHHHHHHTemperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | H2O | protons | 4.792 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | H2O | protons | 4.792 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | H2O | protons | 4.792 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | H2O | protons | 4.792 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
#1 Model Bruker AV500 (500 MHz)
#2 Model Bruker AV500 (600 MHz)
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | coactosin like protein | [U-99% 15N] | 1.4 ~ 1.6 mM | |
2 | PBS buffer | 50 mM | ||
3 | NaCl | 50 mM | ||
4 | D2O | 10 % |
Temperature 296 (±0.5) K, pH 5.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | coactosin like protein | [U-99% 13C; U-99% 15N] | 1.4 ~ 1.6 mM | |
6 | PBS buffer | 50 mM | ||
7 | NaCl | 50 mM | ||
8 | D2O | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6071_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150 VKEVVQNFAKEFVISDRKELEENFIKSELKKAGGANYDAQTELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||| VKEVVQNFAKEFVISDRKELEENFIKSELKKAGGANYDAQTELE -------110-------120-------130-------140----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
15 | ASN | CG | 175.8 |
41 | GLN | CD | 179.7 |
46 | GLN | CD | 179.5 |
50 | GLN | CD | 179.7 |
51 | GLN | CD | 178.8 |
85 | ASN | CG | 176.8 |
90 | GLN | CD | 179.3 |
106 | GLN | CD | 180.4 |
107 | ASN | CG | 177.0 |
123 | ASN | CG | 176.5 |
136 | ASN | CG | 177.0 |
140 | GLN | CD | 180.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 906 | 781 | 86.2 |
13C chemical shifts | 684 | 572 | 83.6 |
15N chemical shifts | 170 | 162 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 309 | 294 | 95.1 |
13C chemical shifts | 300 | 286 | 95.3 |
15N chemical shifts | 149 | 141 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 597 | 487 | 81.6 |
13C chemical shifts | 384 | 286 | 74.5 |
15N chemical shifts | 21 | 21 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 81 | 79 | 97.5 |
13C chemical shifts | 81 | 79 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 87 | 2 | 2.3 |
13C chemical shifts | 85 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |