1H, 13C, and 15N Chemical Shift Assignments for YojN-HPt
MQEAVLQLIE VQLAQEEVTE SPLGGDENAQ LHASGYYALF VDTVPDDVKR LYTEAATSDF AALAQTAHRL KGVFAMLNLV PGKQLCETLE HLIREKDVPG IEKYISDIDS YVKSLL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.2 % (1253 of 1330) | 91.2 % (623 of 683) | 97.3 % (512 of 526) | 97.5 % (118 of 121) |
Backbone | 97.1 % (668 of 688) | 96.6 % (226 of 234) | 97.4 % (333 of 342) | 97.3 % (109 of 112) |
Sidechain | 92.0 % (692 of 752) | 88.4 % (397 of 449) | 97.3 % (286 of 294) | 100.0 % (9 of 9) |
Aromatic | 82.9 % (68 of 82) | 65.9 % (27 of 41) | 100.0 % (41 of 41) | |
Methyl | 98.1 % (157 of 160) | 98.8 % (79 of 80) | 97.5 % (78 of 80) |
1. YojN-HPt
MQEAVLQLIE VQLAQEEVTE SPLGGDENAQ LHASGYYALF VDTVPDDVKR LYTEAATSDF AALAQTAHRL KGVFAMLNLV PGKQLCETLE HLIREKDVPG IEKYISDIDS YVKSLLTemperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
#1 Model Bruker DMX (500 MHz)
#2 Model Bruker DMX (600 MHz)
#3 Model Bruker Avance (700 MHz)
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YojN-HPt | 1 mM | ||
2 | Bis-Tris | 15 mM | ||
3 | NaCl | 15 mM | ||
4 | H2O | 99.99 % |
Temperature 293 (±0.5) K, pH 7.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | YojN-HPt | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Bis-Tris | 15 mM | ||
7 | NaCl | 15 mM | ||
8 | H2O | 5 % | ||
9 | D2O | 95 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6133_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQEAVLQLIEVQLAQEEVTESPLGGDENAQLHASGYYALFVDTVPDDVKRLYTEAATSDFAALAQTAHRLKGVFAMLNLVPGKQLCETLEHLIREKDVPG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQEAVLQLIEVQLAQEEVTESPLGGDENAQLHASGYYALFVDTVPDDVKRLYTEAATSDFAALAQTAHRLKGVFAMLNLVPGKQLCETLEHLIREKDVPG -------110------ IEKYISDIDSYVKSLL |||||||||||||||| IEKYISDIDSYVKSLL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 683 | 624 | 91.4 |
15N chemical shifts | 124 | 121 | 97.6 |
13C chemical shifts | 526 | 524 | 99.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 234 | 232 | 99.1 |
15N chemical shifts | 112 | 112 | 100.0 |
13C chemical shifts | 232 | 232 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 449 | 392 | 87.3 |
15N chemical shifts | 12 | 9 | 75.0 |
13C chemical shifts | 294 | 292 | 99.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 80 | 97.6 |
13C chemical shifts | 82 | 80 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 25 | 61.0 |
13C chemical shifts | 41 | 41 | 100.0 |