1H, 13C, and 15N complete chemical shift assignments for the apo v-Src SH2 domain
QAEEWYFGKI TRRESERLLL NPENPRGTFL VRESETTKGA YCLSVSDFDN AKGLNVKHYK IRKLDSGGFY ITSRTQFSSL QQLVAYYSKH ADGLCHRLTN VCPTSK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.9 % (1143 of 1258) | 90.9 % (597 of 657) | 89.8 % (438 of 488) | 95.6 % (108 of 113) |
Backbone | 94.6 % (596 of 630) | 95.8 % (207 of 216) | 93.6 % (291 of 311) | 95.1 % (98 of 103) |
Sidechain | 88.4 % (643 of 727) | 88.4 % (390 of 441) | 88.0 % (243 of 276) | 100.0 % (10 of 10) |
Aromatic | 55.7 % (68 of 122) | 54.1 % (33 of 61) | 56.7 % (34 of 60) | 100.0 % (1 of 1) |
Methyl | 97.1 % (99 of 102) | 98.0 % (50 of 51) | 96.1 % (49 of 51) |
1. v-Src SH2 domain
QAEEWYFGKI TRRESERLLL NPENPRGTFL VRESETTKGA YCLSVSDFDN AKGLNVKHYK IRKLDSGGFY ITSRTQFSSL QQLVAYYSKH ADGLCHRLTN VCPTSKTemperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
#1 Model Varian UNITY-INOVA (800 MHz)
#2 Model Varian UNITY-INOVA (600 MHz)
#3 Model Varian UNITY-INOVA (500 MHz)
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | v-Src SH2 domain | [U-95% 13C; U-90% 15N] | 0.5 mM | |
2 | NaCl | 50 mM |
Temperature 298 (±0.2) K, pH 6.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | v-Src SH2 domain | [U-90% 15N] | 0.5 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6503_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 QAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTN ------ VCPTSK |||||| VCPTSK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
1 | GLN | CD | 180.933 |
21 | ASN | CG | 177.415 |
50 | ASN | CG | 177.251 |
55 | ASN | CG | 176.947 |
76 | GLN | CD | 179.944 |
81 | GLN | CD | 180.714 |
82 | GLN | CD | 180.347 |
100 | ASN | CG | 177.119 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 488 | 448 | 91.8 |
1H chemical shifts | 657 | 602 | 91.6 |
15N chemical shifts | 121 | 120 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 212 | 201 | 94.8 |
1H chemical shifts | 216 | 215 | 99.5 |
15N chemical shifts | 103 | 102 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 276 | 247 | 89.5 |
1H chemical shifts | 441 | 387 | 87.8 |
15N chemical shifts | 18 | 18 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 51 | 50 | 98.0 |
1H chemical shifts | 51 | 50 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 60 | 32 | 53.3 |
1H chemical shifts | 61 | 33 | 54.1 |
15N chemical shifts | 1 | 1 | 100.0 |