Chemical Shift Assignments for the theta subunit of DNA polymerase III from E. coli
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 72.5 % (671 of 926) | 67.4 % (329 of 488) | 75.8 % (272 of 359) | 88.6 % (70 of 79) |
Backbone | 86.6 % (388 of 448) | 86.6 % (129 of 149) | 85.9 % (195 of 227) | 88.9 % (64 of 72) |
Sidechain | 63.5 % (351 of 553) | 59.0 % (200 of 339) | 70.0 % (145 of 207) | 85.7 % (6 of 7) |
Aromatic | 57.1 % (32 of 56) | 57.1 % (16 of 28) | 55.6 % (15 of 27) | 100.0 % (1 of 1) |
Methyl | 70.7 % (65 of 92) | 73.9 % (34 of 46) | 67.4 % (31 of 46) |
1. theta
MLKNLAKLDQ TEMDKVNVDL AAAGVAFKER YNMPVIAEAV EREQPEHLRS WFRERLIAHR LASVNLSRLP YEPKLKTemperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
#1 Model Varian INOVA (500 MHz) Details Crogenically cooled probe
#2 Model Varian INOVA (800 MHz) Details Room Temperature Probe
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | theta | 600 uM | ||
2 | d3-methanol | 40 v/v | ||
3 | H20 | 100 % |
Temperature 298 (±0.1) K, pH 7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | theta | 600 uM | ||
5 | d3-methanol | 40 v/v | ||
6 | D20 | 100 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6571_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------ MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........DQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 488 | 329 | 67.4 |
13C chemical shifts | 359 | 270 | 75.2 |
15N chemical shifts | 86 | 69 | 80.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 149 | 131 | 87.9 |
13C chemical shifts | 152 | 126 | 82.9 |
15N chemical shifts | 72 | 63 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 339 | 198 | 58.4 |
13C chemical shifts | 207 | 144 | 69.6 |
15N chemical shifts | 14 | 6 | 42.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 34 | 69.4 |
13C chemical shifts | 49 | 31 | 63.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 16 | 57.1 |
13C chemical shifts | 27 | 15 | 55.6 |
15N chemical shifts | 1 | 1 | 100.0 |