NMR chemical shift entry for protein Rv1980c (MPT64) from M. tuberculosis
MAPKTYCEEL KGTDTGQACQ IQMSDPAYNI NISLPSYYPD QKSLENYIAQ TRDKFLSAAT SSTPREAPYE LNITSATYQS AIPPRGTQAV VLKVYQNAGG THPTTTYKAF DWDQAYRKPI TYDTLWQADT DPLPVVFPIV QGELSKQTGQ QVSIAPNAGL DPVNYQNFAV TNDGVIFFFN PGELLPEAAG PTQVLVPRSA IDSMLA
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS7:SG | 1:CYS19:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.6 % (2060 of 2352) | 83.9 % (1019 of 1215) | 91.3 % (842 of 922) | 92.6 % (199 of 215) |
Backbone | 96.9 % (1161 of 1198) | 95.8 % (387 of 404) | 97.7 % (593 of 607) | 96.8 % (181 of 187) |
Sidechain | 80.8 % (1090 of 1349) | 77.9 % (632 of 811) | 86.3 % (440 of 510) | 64.3 % (18 of 28) |
Aromatic | 55.7 % (108 of 194) | 54.6 % (53 of 97) | 57.9 % (55 of 95) | 0.0 % (0 of 2) |
Methyl | 95.2 % (217 of 228) | 94.7 % (108 of 114) | 95.6 % (109 of 114) |
1. Rv1980c (MPT64) polypeptide
MAPKTYCEEL KGTDTGQACQ IQMSDPAYNI NISLPSYYPD QKSLENYIAQ TRDKFLSAAT SSTPREAPYE LNITSATYQS AIPPRGTQAV VLKVYQNAGG THPTTTYKAF DWDQAYRKPI TYDTLWQADT DPLPVVFPIV QGELSKQTGQ QVSIAPNAGL DPVNYQNFAV TNDGVIFFFN PGELLPEAAG PTQVLVPRSA IDSMLATemperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Varian Inova - 600 MHz triple resonance {1H, 15N, 13C} probe (cryoprobe)
State isotropic, Temperature 303 (±0.1) K, pH 6.85 (±0.03), Details MES, D2O, NaN3, DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv1980c (MPT64) polypeptide | [U-15N; U-13C] | protein | 2.0 (±0.05) mM |
2 | MES | buffer | 20 mM | |
3 | D2O | 5 % | ||
4 | NaN3 | 1 mM | ||
5 | DSS | internal reference | 0.2 mM |
Properties
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:7:CYS:SG | 1:19:CYS:SG | oxidized, CA 58.75, CB 39.71 ppm | oxidized, CA 55.03, CB 41.57 ppm | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6688_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGG |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||| ..PKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYY.DQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAI.PRGTQAVVLKVYQNAGG -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 THPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| THPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSA ------ IDSMLA |||||| IDSMLA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
126 | TRP | CD2 | 130.26 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1215 | 995 | 81.9 |
13C chemical shifts | 922 | 831 | 90.1 |
15N chemical shifts | 220 | 199 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 404 | 388 | 96.0 |
13C chemical shifts | 412 | 401 | 97.3 |
15N chemical shifts | 187 | 181 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 811 | 607 | 74.8 |
13C chemical shifts | 510 | 430 | 84.3 |
15N chemical shifts | 33 | 18 | 54.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 117 | 106 | 90.6 |
13C chemical shifts | 117 | 106 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 97 | 51 | 52.6 |
13C chemical shifts | 95 | 53 | 55.8 |
15N chemical shifts | 2 | 0 | 0.0 |