Solution Structure of the hSet2/HYPB SRI domain
GSHMTAEADT SSELAKKSKE VFRKEMSQFI VQCLNPYRKP DCKVGRITTT EDFKHLARKL THGVMNKELK YCKNPEDLEC NENVKHKTKE YIKKYMQKFG AVYKPKEDTE LE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.9 % (1165 of 1372) | 91.5 % (667 of 729) | 73.8 % (389 of 527) | 94.0 % (109 of 116) |
Backbone | 80.6 % (535 of 664) | 95.5 % (214 of 224) | 65.7 % (218 of 332) | 95.4 % (103 of 108) |
Sidechain | 90.1 % (735 of 816) | 89.9 % (454 of 505) | 90.8 % (275 of 303) | 75.0 % (6 of 8) |
Aromatic | 83.3 % (80 of 96) | 83.3 % (40 of 48) | 83.3 % (40 of 48) | |
Methyl | 100.0 % (90 of 90) | 100.0 % (45 of 45) | 100.0 % (45 of 45) |
1. the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1
GSHMTAEADT SSELAKKSKE VFRKEMSQFI VQCLNPYRKP DCKVGRITTT EDFKHLARKL THGVMNKELK YCKNPEDLEC NENVKHKTKE YIKKYMQKFG AVYKPKEDTE LEPressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Model Varian INOVA (600 MHz)
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N] | 2.0 mM | |
2 | KCl | 100 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
6 | KCl | 100 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-15N]-Lys | 2.0 mM | |
10 | KCl | 100 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-95% 13C; U-98% 15N] | 2.0 mM | |
14 | KCl | 100 mM | ||
15 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | 2.0 mM | ||
17 | KCl | 100 mM | ||
18 | D2O | 100 % |
Pressure 1 atm, Temperature 300 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | the Set2-Rpb1-Interacting domain of Huntingtin interacting protein B isoform 1 | [U-10% 13C] | 2.0 mM | |
20 | KCl | 100 mM | ||
21 | D2O | 100 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6834_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFG -------110-- AVYKPKEDTELE |||||||||||| AVYKPKEDTELE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 527 | 381 | 72.3 |
1H chemical shifts | 729 | 662 | 90.8 |
15N chemical shifts | 120 | 110 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 224 | 109 | 48.7 |
1H chemical shifts | 224 | 215 | 96.0 |
15N chemical shifts | 108 | 103 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 303 | 272 | 89.8 |
1H chemical shifts | 505 | 447 | 88.5 |
15N chemical shifts | 12 | 7 | 58.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 49 | 47 | 95.9 |
1H chemical shifts | 49 | 47 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 48 | 40 | 83.3 |
1H chemical shifts | 48 | 40 | 83.3 |