Resonance assignments for the pKM101 homologue of VirB7 (TraN) in complex with the pKM101 homologue of VirB9 (TraO)
GIDPFTHMAG AKNYQYVMSE QPEMRSIQPV HVWDNYRFTR FEFPANAELP QVYMISASGK ETLPNSHVVG ENRNIIEVET VAKEWRIRLG DKVVGVRNNN FAPGAGAVAT GTASPDVRRV QIGEDN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.7 % (1660 of 1831) | 90.8 % (867 of 955) | 90.7 % (640 of 706) | 90.0 % (153 of 170) |
Backbone | 91.1 % (860 of 944) | 90.1 % (292 of 324) | 91.9 % (434 of 472) | 90.5 % (134 of 148) |
Sidechain | 90.6 % (938 of 1035) | 91.1 % (575 of 631) | 90.1 % (344 of 382) | 86.4 % (19 of 22) |
Aromatic | 77.6 % (104 of 134) | 85.1 % (57 of 67) | 70.3 % (45 of 64) | 66.7 % (2 of 3) |
Methyl | 96.2 % (150 of 156) | 96.2 % (75 of 78) | 96.2 % (75 of 78) |
1. VirB7
GAMASGHKPP PEPDWSNTVP VNKTIPVDTQ GGRNES2. VirB9
GIDPFTHMAG AKNYQYVMSE QPEMRSIQPV HVWDNYRFTR FEFPANAELP QVYMISASGK ETLPNSHVVG ENRNIIEVET VAKEWRIRLG DKVVGVRNNN FAPGAGAVAT GTASPDVRRV QIGEDNTemperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
#1 Model Varian Unity Plus (500 MHz)
#2 Model Varian Inova (600 MHz)
#3 Model Varian Inova (800 MHz)
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VirB7 | [U-15N] | 1 mM | |
2 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | VirB7 | [U-13C; U-15N] | 1 mM | |
4 | VirB9 | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VirB7 | 1 mM | ||
6 | VirB9 | [U-15N] | 1 mM |
Temperature 298 K, pH 6.7 (±0.1), Details Complex between VirB7 and the C-terminal domain of VirB9 of the homologues of pKM101
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VirB7 | 1 mM | ||
8 | VirB9 | [U-13C; U-15N] | 1 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr6936_3.str
Assigned chemical shifts
--------10--------20--------30------ GAMASGHKPPPEPDWSNTVPVNKTIPVDTQGGRNES |||||||||||||||||||||||||||||||| ....SGHKPPPEPDWSNTVPVNKTIPVDTQGGRNES
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTHMAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFEFPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........AGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFEFPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNN -------110-------120------ FAPGAGAVATGTASPDVRRVQIGEDN |||||||||||||||||||||||||| FAPGAGAVATGTASPDVRRVQIGEDN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 204 | 184 | 90.2 |
13C chemical shifts | 148 | 131 | 88.5 |
15N chemical shifts | 36 | 30 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 59 | 84.3 |
13C chemical shifts | 72 | 60 | 83.3 |
15N chemical shifts | 30 | 26 | 86.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 134 | 125 | 93.3 |
13C chemical shifts | 76 | 71 | 93.4 |
15N chemical shifts | 6 | 4 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 11 | 78.6 |
13C chemical shifts | 14 | 11 | 78.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 8 | 7 | 87.5 |
13C chemical shifts | 7 | 7 | 100.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 751 | 680 | 90.5 |
13C chemical shifts | 558 | 503 | 90.1 |
15N chemical shifts | 144 | 121 | 84.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 254 | 232 | 91.3 |
13C chemical shifts | 252 | 234 | 92.9 |
15N chemical shifts | 118 | 106 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 497 | 448 | 90.1 |
13C chemical shifts | 306 | 269 | 87.9 |
15N chemical shifts | 26 | 15 | 57.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 65 | 94.2 |
13C chemical shifts | 69 | 65 | 94.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 50 | 84.7 |
13C chemical shifts | 57 | 38 | 66.7 |
15N chemical shifts | 2 | 2 | 100.0 |