1H, 13C, and 15N Resonance Assignments of the VAP-A: OSBP Complex
GPLGSDHEQI LVLDPPTDLK FKGPFTDVVT TNLKLRNPSD RKVCFKVKTT APRRYCVRPN SGIIDPGSTV TVSVMLQPFD YDPNEKSKHK FMVQTIFAPP NTSDMEAVWK EAKPDELMDS KLRCVFEMPN E
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.9 % (1788 of 2081) | 88.3 % (963 of 1091) | 81.6 % (665 of 815) | 91.4 % (160 of 175) |
Backbone | 93.8 % (976 of 1040) | 93.2 % (328 of 352) | 94.1 % (495 of 526) | 94.4 % (153 of 162) |
Sidechain | 80.4 % (972 of 1209) | 85.9 % (635 of 739) | 72.2 % (330 of 457) | 53.8 % (7 of 13) |
Aromatic | 33.5 % (57 of 170) | 58.8 % (50 of 85) | 7.2 % (6 of 83) | 50.0 % (1 of 2) |
Methyl | 97.3 % (146 of 150) | 97.3 % (73 of 75) | 97.3 % (73 of 75) |
1. vesicle-associated membrane protein-associated protein-A
GPLGSDHEQI LVLDPPTDLK FKGPFTDVVT TNLKLRNPSD RKVCFKVKTT APRRYCVRPN SGIIDPGSTV TVSVMLQPFD YDPNEKSKHK FMVQTIFAPP NTSDMEAVWK EAKPDELMDS KLRCVFEMPN E2. oxisterol-binding protein
GPLGSDHWGK GDMSDEDDEN EFFDAPEIIT MPENLGHKRT GSHHHHHHTemperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
#1 Model Bruker AVANCE (500 MHz)
#2 Model Bruker DRX (800 MHz)
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | vesicle-associated membrane protein-associated protein-A | [U-13C; U-15N] | protein | 1.0 (±0.2) mM |
2 | oxisterol-binding protein | protein | 1.0 (±0.2) mM | |
3 | K phosphate | buffer | 50 mM | |
4 | KCl | salt | 100 mM | |
5 | DTT | reducing agent | 1 mM | |
6 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | vesicle-associated membrane protein-associated protein-A | protein | 1.0 (±0.2) mM | |
8 | oxisterol-binding protein | [U-13C; U15N] | protein | 1.0 (±0.2) mM |
9 | K phosphate | buffer | 50 mM | |
10 | KCl | salt | 100 mM | |
11 | DTT | reducing agent | 1 mM | |
12 | EDTA | chelating agent | 0.1 mM |
Temperature 303 (±0.5) K, pH 6.9 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | vesicle-associated membrane protein-associated protein-A | [U-15N] | protein | 1.0 (±0.2) mM |
14 | oxisterol-binding protein | [U-15N] | protein | 1.0 (±0.2) mM |
15 | K phosphate | buffer | 50 mM | |
16 | KCl | salt | 100 mM | |
17 | DTT | reducing agent | 1 mM | |
18 | EDTA | chelating agent | 0.1 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr7025_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPLGSDHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GSDHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPP -------110-------120-------130- NTSDMEAVWKEAKPDELMDSKLRCVFEMPNE ||||||||||||||||||||||||||||||| NTSDMEAVWKEAKPDELMDSKLRCVFEMPNE
--------10--------20--------30--------40-------- GPLGSDHWGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSHHHHHH ||||||||||||||||||||||||||||||||||||||||| .PLGSDHWGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGS --------10--------20--------30--------40--
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 816 | 732 | 89.7 |
13C chemical shifts | 609 | 503 | 82.6 |
15N chemical shifts | 133 | 119 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 253 | 246 | 97.2 |
13C chemical shifts | 262 | 253 | 96.6 |
15N chemical shifts | 117 | 115 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 563 | 486 | 86.3 |
13C chemical shifts | 347 | 250 | 72.0 |
15N chemical shifts | 16 | 4 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 62 | 89.9 |
13C chemical shifts | 69 | 62 | 89.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 40 | 75.5 |
13C chemical shifts | 52 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 275 | 219 | 79.6 |
13C chemical shifts | 206 | 149 | 72.3 |
15N chemical shifts | 49 | 41 | 83.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 99 | 84 | 84.8 |
13C chemical shifts | 96 | 82 | 85.4 |
15N chemical shifts | 45 | 38 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 176 | 135 | 76.7 |
13C chemical shifts | 110 | 67 | 60.9 |
15N chemical shifts | 4 | 3 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 11 | 84.6 |
13C chemical shifts | 13 | 11 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 8 | 25.0 |
13C chemical shifts | 31 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |