Complete 1H, 13C, and 15N Chemical Shift Assignments for the 15.5K Protein
MGHHHHHHSS GIEEGRMTEA DVNPKAYPLA DAHLTKKLLD LVQQSCNYKQ LRKGANEATK TLNRGISEFI VMAADAEPLE IILHLPLLCE DKNVPYVFVR SKQALGRACG VSRPVIACSV TIKEGSQLKQ QIQSIQQSIE RLLV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.9 % (1454 of 1674) | 86.2 % (753 of 874) | 87.9 % (569 of 647) | 86.3 % (132 of 153) |
Backbone | 93.4 % (796 of 852) | 93.4 % (271 of 290) | 93.4 % (396 of 424) | 93.5 % (129 of 138) |
Sidechain | 82.2 % (787 of 958) | 82.5 % (482 of 584) | 84.1 % (302 of 359) | 20.0 % (3 of 15) |
Aromatic | 43.4 % (33 of 76) | 55.3 % (21 of 38) | 31.6 % (12 of 38) | |
Methyl | 93.8 % (167 of 178) | 95.5 % (85 of 89) | 92.1 % (82 of 89) |
1. His-15.5K
MGHHHHHHSS GIEEGRMTEA DVNPKAYPLA DAHLTKKLLD LVQQSCNYKQ LRKGANEATK TLNRGISEFI VMAADAEPLE IILHLPLLCE DKNVPYVFVR SKQALGRACG VSRPVIACSV TIKEGSQLKQ QIQSIQQSIE RLLVTemperature 293 (±0.1) K, pH 6.0 (±0.05), Details Sample first used for backbone assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 0.9 (±0.1) mM |
2 | sodium phosphate | buffer | 50 (±5.0) mM | |
3 | sodium chloride | salt | 200 (±20.0) mM | |
4 | sodium azide | salt | 0.1 (±0.1) % w/w |
Temperature 293 (±0.1) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 1.6 (±0.2) mM |
6 | sodium phosphate | buffer | 100 (±10.0) mM | |
7 | sodium chloride | salt | 100 (±10.0) mM | |
8 | sodium azide | salt | 0.1 (±0.1) % w/w |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Inova - 600 MHz EMSL 600 MHz equipped with cold probe
State isotropic, Temperature 297 (±0.1) K, pH 6.0 (±0.05), Details Sample first used for backbone assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 0.9 (±0.1) mM |
2 | sodium phosphate | buffer | 50 (±5.0) mM | |
3 | sodium chloride | salt | 200 (±20.0) mM | |
4 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz EMSL 600 MHz equipped with cold probe
State isotropic, Temperature 297 (±0.1) K, pH 6.0 (±0.05), Details Sample first used for backbone assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 0.9 (±0.1) mM |
2 | sodium phosphate | buffer | 50 (±5.0) mM | |
3 | sodium chloride | salt | 200 (±20.0) mM | |
4 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz EMSL 600 MHz equipped with cold probe
State isotropic, Temperature 297 (±0.1) K, pH 6.0 (±0.05), Details Sample first used for backbone assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 0.9 (±0.1) mM |
2 | sodium phosphate | buffer | 50 (±5.0) mM | |
3 | sodium chloride | salt | 200 (±20.0) mM | |
4 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz EMSL 600 MHz equipped with cold probe
State isotropic, Temperature 297 (±0.1) K, pH 6.0 (±0.05), Details Sample first used for backbone assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 0.9 (±0.1) mM |
2 | sodium phosphate | buffer | 50 (±5.0) mM | |
3 | sodium chloride | salt | 200 (±20.0) mM | |
4 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz University of Utah Dept of Biochemistry 600 MHz with cold probe
State isotropic, Temperature 293 (±0.1) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 1.6 (±0.2) mM |
6 | sodium phosphate | buffer | 100 (±10.0) mM | |
7 | sodium chloride | salt | 100 (±10.0) mM | |
8 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz University of Utah Dept of Biochemistry 600 MHz with cold probe
State isotropic, Temperature 293 (±0.1) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 1.6 (±0.2) mM |
6 | sodium phosphate | buffer | 100 (±10.0) mM | |
7 | sodium chloride | salt | 100 (±10.0) mM | |
8 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz University of Utah Dept of Biochemistry 600 MHz with cold probe
State isotropic, Temperature 293 (±0.1) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 1.6 (±0.2) mM |
6 | sodium phosphate | buffer | 100 (±10.0) mM | |
7 | sodium chloride | salt | 100 (±10.0) mM | |
8 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz University of Utah Dept of Biochemistry 600 MHz with cold probe
State isotropic, Temperature 293 (±0.1) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 1.6 (±0.2) mM |
6 | sodium phosphate | buffer | 100 (±10.0) mM | |
7 | sodium chloride | salt | 100 (±10.0) mM | |
8 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz EMSL 600 MHz equipped with cold probe
State isotropic, Temperature 297 (±0.1) K, pH 6.0 (±0.05), Details Sample first used for backbone assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 0.9 (±0.1) mM |
2 | sodium phosphate | buffer | 50 (±5.0) mM | |
3 | sodium chloride | salt | 200 (±20.0) mM | |
4 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz University of Utah Dept of Biochemistry 600 MHz with cold probe
State isotropic, Temperature 293 (±0.1) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 1.6 (±0.2) mM |
6 | sodium phosphate | buffer | 100 (±10.0) mM | |
7 | sodium chloride | salt | 100 (±10.0) mM | |
8 | sodium azide | salt | 0.1 (±0.1) % w/w |
Varian Inova - 600 MHz University of Utah Dept of Biochemistry 600 MHz with cold probe
State isotropic, Temperature 293 (±0.1) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | His-15.5K | [U-98% 13C; U-98% 15N] | protein | 1.6 (±0.2) mM |
6 | sodium phosphate | buffer | 100 (±10.0) mM | |
7 | sodium chloride | salt | 100 (±10.0) mM | |
8 | sodium azide | salt | 0.1 (±0.1) % w/w |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr7249_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSSGIEEGRMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........SSGIEEGRMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVR -------110-------120-------130-------140---- SKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |||||||||||||||||||||||||||||||||||||||||||| SKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 874 | 741 | 84.8 |
13C chemical shifts | 647 | 557 | 86.1 |
15N chemical shifts | 160 | 130 | 81.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 290 | 270 | 93.1 |
13C chemical shifts | 288 | 261 | 90.6 |
15N chemical shifts | 138 | 128 | 92.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 584 | 471 | 80.7 |
13C chemical shifts | 359 | 296 | 82.5 |
15N chemical shifts | 22 | 2 | 9.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 92 | 87 | 94.6 |
13C chemical shifts | 92 | 81 | 88.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 18 | 47.4 |
13C chemical shifts | 38 | 9 | 23.7 |