Segmental Isotope Labeling of Npl3p
MGSSHHHHHH SSGLVPRGSH MSKLPAKRYR ITMKNLPEGC SWQDLKDLAR ENSLETTFSS VNTRDFDGTG ALEFPSEEIL VEALERLNNI EFRGSVITVE RDDNPPPIRR S
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 61.8 % (786 of 1272) | 66.0 % (440 of 667) | 53.1 % (262 of 493) | 75.0 % (84 of 112) |
Backbone | 60.6 % (395 of 652) | 69.8 % (155 of 222) | 50.0 % (163 of 326) | 74.0 % (77 of 104) |
Sidechain | 64.2 % (465 of 724) | 64.0 % (285 of 445) | 63.8 % (173 of 271) | 87.5 % (7 of 8) |
Aromatic | 43.2 % (38 of 88) | 52.3 % (23 of 44) | 32.6 % (14 of 43) | 100.0 % (1 of 1) |
Methyl | 80.0 % (80 of 100) | 80.0 % (40 of 50) | 80.0 % (40 of 50) |
1. Npl3p RRM2
MGSSHHHHHH SSGLVPRGSH MSKLPAKRYR ITMKNLPEGC SWQDLKDLAR ENSLETTFSS VNTRDFDGTG ALEFPSEEIL VEALERLNNI EFRGSVITVE RDDNPPPIRR SSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
5 | D2O | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Npl3p RRM2 | [U-15N] | 1 mM | |
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
Bruker DRX - 500 MHz equipped with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker DRX - 500 MHz equipped with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker DRX - 500 MHz equipped with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker DRX - 500 MHz equipped with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker DRX - 500 MHz equipped with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker DRX - 500 MHz equipped with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker DRX - 500 MHz equipped with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
5 | D2O | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Npl3p RRM2 | [U-13C; U-15N] | 1 mM | |
5 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15487_2jvr.nef |
Input source #2: Coordindates | 2jvr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVE -------110- RDDNPPPIRRS ||||||||||| RDDNPPPIRRS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 111 | 0 | 0 | 100.0 |
Content subtype: combined_15487_2jvr.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVE ||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........................PAKRYRITMKN..EGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110- RDDNPPPIRRS |||| RDDN ----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 667 | 423 | 63.4 |
13C chemical shifts | 493 | 230 | 46.7 |
15N chemical shifts | 122 | 82 | 67.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 150 | 67.6 |
13C chemical shifts | 222 | 67 | 30.2 |
15N chemical shifts | 104 | 75 | 72.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 445 | 273 | 61.3 |
13C chemical shifts | 271 | 163 | 60.1 |
15N chemical shifts | 18 | 7 | 38.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 39 | 73.6 |
13C chemical shifts | 53 | 39 | 73.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 23 | 52.3 |
13C chemical shifts | 43 | 14 | 32.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVE ||||||||||| ||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||| ........................PAKRYRITMKN..EGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEF.SEEILVEALERLNNIEFRGSVITVE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110- RDDNPPPIRRS |||| RDDN ----
Dihedral angle restraints