Refined solution structure of recombinant brazzein at low temperature
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.3 % (586 of 635) | 90.8 % (306 of 337) | 93.3 % (223 of 239) | 96.6 % (57 of 59) |
Backbone | 97.8 % (309 of 316) | 98.1 % (104 of 106) | 98.1 % (155 of 158) | 96.2 % (50 of 52) |
Sidechain | 88.7 % (329 of 371) | 87.4 % (202 of 231) | 90.2 % (120 of 133) | 100.0 % (7 of 7) |
Aromatic | 58.1 % (36 of 62) | 58.1 % (18 of 31) | 58.1 % (18 of 31) | |
Methyl | 100.0 % (28 of 28) | 100.0 % (14 of 14) | 100.0 % (14 of 14) |
1. entity
DKCKKVYENY PVSKCQLANQ CNYDCKLDKH ARSGECFYDE KRNLQCICDY CEYSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 126.692 ppm | internal | indirect | 0.25 |
1H | water | protons | 4.993 ppm | internal | direct | 1.0 |
15N | water | protons | 119.434 ppm | internal | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 126.692 ppm | internal | indirect | 0.25 |
1H | water | protons | 4.993 ppm | internal | direct | 1.0 |
15N | water | protons | 119.434 ppm | internal | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 126.692 ppm | internal | indirect | 0.25 |
1H | water | protons | 4.993 ppm | internal | direct | 1.0 |
15N | water | protons | 119.434 ppm | internal | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 126.692 ppm | internal | indirect | 0.25 |
1H | water | protons | 4.993 ppm | internal | direct | 1.0 |
15N | water | protons | 119.434 ppm | internal | indirect | 0.1 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.2 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | brazzein | [U-13C; U-15N] | 1.0 ~ 2.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 5 (±0.1) mM | |
3 | H2O | natural abundance | 93 % | |
4 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Dihedral angle restraints | combined_18710_2ly6.nef |
Input source #2: Coordindates | 2ly6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:4:CYS:SG | A:52:CYS:SG | oxidized, CA 57.281, CB 41.329 ppm | oxidized, CA 55.025, CB 44.241 ppm | 2.02 |
A:16:CYS:SG | A:37:CYS:SG | oxidized, CA 58.052, CB 40.413 ppm | oxidized, CA 56.316, CB 45.938 ppm | 2.019 |
A:22:CYS:SG | A:47:CYS:SG | oxidized, CA 58.392, CB 38.574 ppm | oxidized, CA 55.011, CB 38.063 ppm | 2.02 |
A:22:CYS:SG | A:37:CYS:SG | oxidized, CA 58.392, CB 38.574 ppm | oxidized, CA 56.316, CB 45.938 ppm | 2.952 |
A:26:CYS:SG | A:49:CYS:SG | oxidized, CA 60.528, CB 36.64 ppm | oxidized, CA 51.59, CB 35.534 ppm | 2.02 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------10--------20--------30--------40--------50---- DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY ||||||||||||||||||||||||||||||||||||||||||||||||||||| DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY --------10--------20--------30--------40--------50---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 53 | 0 | 0 | 100.0 |
Content subtype: combined_18710_2ly6.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50---- DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY ||||||||||||||||||||||||||||||||||||||||||||||||||||| DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
11 | TYR | HH | 10.13 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 337 | 299 | 88.7 |
13C chemical shifts | 239 | 223 | 93.3 |
15N chemical shifts | 61 | 59 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 106 | 104 | 98.1 |
13C chemical shifts | 106 | 103 | 97.2 |
15N chemical shifts | 52 | 50 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 231 | 195 | 84.4 |
13C chemical shifts | 133 | 120 | 90.2 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 14 | 100.0 |
13C chemical shifts | 14 | 14 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 18 | 58.1 |
13C chemical shifts | 31 | 18 | 58.1 |
Covalent bonds
Dihedral angle restraints
-------10--------20--------30--------40--------50---- DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY ||||||||||||||||||||||||||||||||||||||||||||||||||||| DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY