BMRBj - BMREntryMaster

Found 1 Document (0.927 seconds)

BMRB: 25800

2N7C

Solution structure of Plasmodium falciparum SR1-RRM1 in complex with ACAUCA RNA

Authors

Ganguly, A.K., Verma, G., Bhavesh, N.

Assembly

Plasmodium falciparum SR1-RRM1 in complex with ACAUCA RNA

Entity

1. PfSR1-RRM1 (polymer, Thiol state: all free), 89 monomers, 9981.065 Da Detail

GSHMVIRESV SRIYVGNLPS HVSSRDVENE FRKYGNILKC DVKKTVSGAA FAFIEFEDAR DAADAIKEKD GCDFEGNKLR VEVPFNARE

2. RNA (5'-R(*AP*CP*AP*UP*CP*A)-3') (polymer), 6 monomers, 1922.162 Da Detail

ACAUCA

Total weight

11903.228 Da

Max. entity weight

9981.065 Da

Source organism

Plasmodium falciparum

Exptl. method

solution NMR

Refine. method

DGSA-distance geometry simulated annealing, simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete1

Sequence coverage: 92.6 %, Completeness: 71.4 %, Completeness (bb): 86.6 % Detail

Polymer type: polypeptide(L) polyribonucleotide

	Total	¹H	¹³C	¹⁵N
All	71.4 % (796 of 1115)	60.4 % (353 of 584)	81.7 % (358 of 438)	91.4 % (85 of 93)
Backbone	86.6 % (516 of 596)	81.2 % (177 of 218)	87.3 % (254 of 291)	97.7 % (85 of 87)
Sidechain	60.1 % (362 of 602)	48.1 % (176 of 366)	80.9 % (186 of 230)	0.0 % (0 of 6)
Aromatic	29.1 % (32 of 110)	27.3 % (15 of 55)	31.5 % (17 of 54)	0.0 % (0 of 1)
Methyl	58.1 % (50 of 86)	20.9 % (9 of 43)	95.3 % (41 of 43)

1. PfSR1-RRM1

GSHMVIRESV SRIYVGNLPS HVSSRDVENE FRKYGNILKC DVKKTVSGAA FAFIEFEDAR DAADAIKEKD GCDFEGNKLR VEVPFNARE

2. RNA (5'-R(*AP*CP*AP*UP*CP*A)-3')

ACAUCA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

Chem. Shift Complete2

Sequence coverage: 27.4 %, Completeness: 45.0 %, Completeness (bb): 55.3 % Detail

Polymer type: polypeptide(L) polyribonucleotide

	Total	¹H	¹³C	¹⁵N
All	45.0 % (1003 of 2230)	39.3 % (459 of 1168)	50.0 % (438 of 876)	57.0 % (106 of 186)
Backbone	55.3 % (659 of 1192)	55.5 % (242 of 436)	53.6 % (312 of 582)	60.3 % (105 of 174)
Sidechain	36.2 % (436 of 1204)	29.6 % (217 of 732)	47.4 % (218 of 460)	8.3 % (1 of 12)
Aromatic	25.5 % (56 of 220)	24.5 % (27 of 110)	26.9 % (29 of 108)	0.0 % (0 of 2)
Methyl	33.1 % (57 of 172)	15.1 % (13 of 86)	51.2 % (44 of 86)

1. PfSR1-RRM1

GSHMVIRESV SRIYVGNLPS HVSSRDVENE FRKYGNILKC DVKKTVSGAA FAFIEFEDAR DAADAIKEKD GCDFEGNKLR VEVPFNARE

2. RNA (5'-R(*AP*CP*AP*UP*CP*A)-3')

ACAUCA

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.1 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.1 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.06 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.3 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2N7C, Strand ID: A Detail

Release date

2015-10-08

Citation

The N-terminal RNA Recognition Motif of PfSR1 Confers Semi-specificity for Pyrimidines during RNA Recognition
Ganguly, A.K., Verma, G., Bhavesh, N.
J. Mol. Biol. (2018), PubMed 30500338 , DOI 10.1016/j.jmb.2018.11.020 , Abstract

Entries sharing articles BMRB: 2 entries Detail

  BMRB: 25650 released on 2016-07-17
    Title Solution structure of RNA recognition motif-1 of Plasmodium falciparum serine/arginine-rich protein 1.
  BMRB: 25779 released on 2015-08-27
    Title Partial 1H, 13C and 15N backbone resonance assignments for the carboxy-terminal RNA recognition motif of Plasmodium falciparum Ser/Arg-rich protein 1

Related entities 1. PfSR1-RRM1, : 1 : 1 : 1 : 310 entities Detail

Experiments performed 17 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

2 2D 1H-13C HSQC aliphatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

3 2D 1H-13C HSQC aromatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

4 3D HNCACB

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

5 2D 1H-1H NOESY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

6 2D 1H-1H TOCSY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

7 3D 1H-15N NOESY

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

8 2D 1H-13C HSQC aliphatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

9 2D 1H-13C HSQC aromatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

10 2D 1H-1H TOCSY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

11 2D 1H-1H NOESY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

12 3D 1H-13C NOESY aromatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

13 3D 1H-13C NOESY aromatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

14 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
1	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
2	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
3	sodium phosphate	natural abundance	25 mM
4	sodium chloride	natural abundance	100 mM
5	TCEP	natural abundance	3 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

15 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

16 2D 13C(F1)-filtered, 13C(F2)-filtered 1H-1H NOESY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

17 2D 13C(F2)-edited 1H-1H NOESY aromatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9

#	Name	Isotope labeling	Concentration
8	PfSR1-RRM1	[U-100% 13C; U-100% 15N]	0.5 ~ 1.0 mM
9	RNA (5'-R(APCPAPUPCPA)-3')	natural abundance	0.5 ~ 1.0 mM
10	sodium phosphate	natural abundance	25 mM
11	sodium chloride	natural abundance	100 mM
12	TCEP	natural abundance	3 mM
13	D2O	natural abundance	100 %

NMR combined restraints 8 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_25800_2n7c.nef
Input source #2: Coordindates	2n7c.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

-----------10--------20--------30--------40--------50--------60--------70--------80------
GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDVKKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDVKKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE
--------10--------20--------30--------40--------50--------60--------70--------80---------

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

------
ACAUCA
||||||
ACAUCA

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	89	0	0	100.0
B	B	6	0	0	100.0

Content subtype: combined_25800_2n7c.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	766		97.8 (chain: A, length: 89)
2	Assigned chemical shifts	assigned_chem_shift_list_2	Warning	90		100.0 (chain: B, length: 6)
1	Distance restraints	DYANA/DIANA_distance_constraints_3	OK	1137 (1)	noe	95.5 (chain: A, length: 89), 50.0 (chain: B, length: 6)
2	Distance restraints	DYANA/DIANA_distance_constraints_5	OK	6 (1)	noe	50.0 (chain: B, length: 6)
3	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	48 (1)	hbond	39.3 (chain: A, length: 89)
4	Distance restraints	DYANA/DIANA_distance_constraints_4	Warning	48 (1)	hbond	39.3 (chain: A, length: 89)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_6	OK	133 (133)	.	84.3 (chain: A, length: 89)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 89, Sequence coverage: 97.8%
- Total number of assignments
  - ¹H chemical shifts: 326
  - ¹³C chemical shifts: 356
  - ¹⁵N chemical shifts: 84
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chem_shift_list_2
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: B, Chain length: 6, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 48
  - ¹³C chemical shifts: 42
- Completeness of assignments
  - Entity_assemble_ID: B
- Histogram of normalized assigned chemical shifts

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	531	326	61.4
¹³C chemical shifts	396	356	89.9
¹⁵N chemical shifts	99	84	84.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	182	175	96.2
¹³C chemical shifts	178	171	96.1
¹⁵N chemical shifts	87	84	96.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	349	151	43.3
¹³C chemical shifts	218	185	84.9
¹⁵N chemical shifts	12	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	44	0	0.0
¹³C chemical shifts	44	41	93.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	42	14	33.3
¹³C chemical shifts	42	16	38.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	53	48	90.6
¹³C chemical shifts	42	42	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	36	36	100.0
¹³C chemical shifts	30	30	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	17	12	70.6
¹³C chemical shifts	12	12	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	6	6	100.0
¹³C chemical shifts	6	6	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_3
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 89, Sequence coverage: 95.5%
  - Entity_assembly_ID: B, Chain length: 6, Sequence coverage: 50.0%
- Total number of restraints: 1137
- Weight of restraints: 1.0 (1137)
- Potential type of restraints: upper-bound-parabolic (1137)
- Range of distance target values: 1.5, 5.7 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_5
  - Status: OK
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: B, Chain length: 6, Sequence coverage: 50.0%
  - Total number of restraints: 6
  - Weight of restraints: 1.0 (6)
  - Potential type of restraints: upper-bound-parabolic (6)
  - Range of distance target values: 3.0, 3.5 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
      None
    - Chain_ID: B
  - Distance restraints on contact map
  - Saveframe: DYANA/DIANA_distance_constraints_2
    - Status: OK
    - Experiment type: hbond
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 89, Sequence coverage: 39.3%
    - Total number of restraints: 48
    - Weight of restraints: 1.0 (48)
    - Potential type of restraints: upper-bound-parabolic (48)
    - Range of distance target values: 2.6, 3.6 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
      - Chain_ID: B
        None
    - Distance restraints on contact map
    - Saveframe: DYANA/DIANA_distance_constraints_4
      - Status: Warning
      - Experiment type: hbond
      - Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 89, Sequence coverage: 39.3%
      - Total number of restraints: 48
        Total hydrogen bond restraints: 48
        O...H-x (too close!): 10
        O...h-N (too close!): 10
        Long range: 28
        O...H-x (too close!): 14
        O...h-N (too close!): 14
      - Weight of restraints: 1.0 (48)
        Total hydrogen bond restraints: 1.0 (48)
        O...H-x (too close!): 1.0 (10)
        O...h-N (too close!): 1.0 (10)
        Long range: 1.0 (28)
        O...H-x (too close!): 1.0 (14)
        O...h-N (too close!): 1.0 (14)
      - Potential type of restraints: upper-bound-parabolic (48)
        Total hydrogen bond restraints: upper-bound-parabolic (48)
        O...H-x (too close!): upper-bound-parabolic (10)
        O...h-N (too close!): upper-bound-parabolic (10)
        Long range: upper-bound-parabolic (28)
        O...H-x (too close!): upper-bound-parabolic (14)
        O...h-N (too close!): upper-bound-parabolic (14)
      - Range of distance target values: 1.8, 2.4 (Å)
      - Histogram of distance target values
      - Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
      - Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_6
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 89, Sequence coverage: 84.3%
- Total number of restraints: 133
- Total number of restraints per polymer type: 133
- Weight of restraints: 1.0 (133)
- Potential type of restraints: square-well-parabolic (133)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords Alternative splicing, Plasmodium falciparum, Protein-RNA complex, Serine/Arginine rich protein

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.927 seconds)

BMRB: 25800

Sample #1

Sample #2

Sample #1

Sample #2

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Entries sharing articles BMRB: 2 entries Detail

Related entities 1. PfSR1-RRM1, : 1 : 1 : 1 : 310 entities Detail

Experiments performed 17 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 8 contents Detail