NMR resonance assignments for the GSPII-B domain of the traffic ATPase PilF from Thermus thermophilus in the apo and c-di-GMP-bound states
GSSGEGQKDL KLGELLLQKG WISREALEEA LVEQEKTGDL LGRILVRKGL PEEALYRALA EQKGLEFLES TEGIVPDPSA ALLLLRSDAL RYGAVPIGFQ NGEVEVVLSD PRHKEAVAQL LNRPARFYLA LPQAWEELFR RAYPQK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.4 % (1677 of 1722) | 96.2 % (869 of 903) | 98.7 % (660 of 669) | 98.7 % (148 of 150) |
Backbone | 98.5 % (847 of 860) | 96.6 % (287 of 297) | 99.5 % (423 of 425) | 99.3 % (137 of 138) |
Sidechain | 96.7 % (962 of 995) | 96.0 % (582 of 606) | 97.9 % (369 of 377) | 91.7 % (11 of 12) |
Aromatic | 97.0 % (97 of 100) | 98.0 % (49 of 50) | 95.8 % (46 of 48) | 100.0 % (2 of 2) |
Methyl | 97.3 % (181 of 186) | 100.0 % (93 of 93) | 94.6 % (88 of 93) |
1. PilF159-302
GSSGEGQKDL KLGELLLQKG WISREALEEA LVEQEKTGDL LGRILVRKGL PEEALYRALA EQKGLEFLES TEGIVPDPSA ALLLLRSDAL RYGAVPIGFQ NGEVEVVLSD PRHKEAVAQL LNRPARFYLA LPQAWEELFR RAYPQKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 541 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM | |
7 | c-di-GMP | natural abundance | 812 uM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27853_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSSGEGQKDLKLGELLLQKGWISREALEEALVEQEKTGDLLGRILVRKGLPEEALYRALAEQKGLEFLESTEGIVPDPSAALLLLRSDALRYGAVPIGFQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SSGEGQKDLKLGELLLQKGWISREALEEALVEQEKTGDLLGRILVRKGLPEEALYRALAEQKGLEFLESTEGIVPDPSAALLLLRSDALRYGAVPIGFQ -------110-------120-------130-------140------ NGEVEVVLSDPRHKEAVAQLLNRPARFYLALPQAWEELFRRAYPQK |||||||||||||||||||||||||||||||||||||||||||||| NGEVEVVLSDPRHKEAVAQLLNRPARFYLALPQAWEELFRRAYPQK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
92 | TYR | HH | 8.66 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 903 | 884 | 97.9 |
13C chemical shifts | 669 | 658 | 98.4 |
15N chemical shifts | 161 | 147 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 297 | 293 | 98.7 |
13C chemical shifts | 292 | 289 | 99.0 |
15N chemical shifts | 138 | 136 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 606 | 591 | 97.5 |
13C chemical shifts | 377 | 369 | 97.9 |
15N chemical shifts | 23 | 11 | 47.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 93 | 93 | 100.0 |
13C chemical shifts | 93 | 88 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 49 | 98.0 |
13C chemical shifts | 48 | 46 | 95.8 |
15N chemical shifts | 2 | 2 | 100.0 |