NMR resonance assignments for the GSPII-B domain of the traffic ATPase PilF from Thermus thermophilus in the apo and c-di-GMP-bound states
GSSGEGQKDL KLGELLLQKG WISREALEEA LVEQEKTGDL LGRILVRKGL PEEALYRALA EQKGLEFLES TEGIVPDPSA ALLLLRSDAL RYGAVPIGFQ NGEVEVVLSD PRHKEAVAQL LNRPARFYLA LPQAWEELFR RAYPQK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.7 % (1666 of 1722) | 95.9 % (866 of 903) | 97.5 % (652 of 669) | 98.7 % (148 of 150) |
Backbone | 98.7 % (849 of 860) | 99.0 % (294 of 297) | 98.6 % (419 of 425) | 98.6 % (136 of 138) |
Sidechain | 95.4 % (949 of 995) | 94.4 % (572 of 606) | 96.8 % (365 of 377) | 100.0 % (12 of 12) |
Aromatic | 80.0 % (80 of 100) | 80.0 % (40 of 50) | 79.2 % (38 of 48) | 100.0 % (2 of 2) |
Methyl | 96.8 % (180 of 186) | 94.6 % (88 of 93) | 98.9 % (92 of 93) |
1. PilF159-302
GSSGEGQKDL KLGELLLQKG WISREALEEA LVEQEKTGDL LGRILVRKGL PEEALYRALA EQKGLEFLES TEGIVPDPSA ALLLLRSDAL RYGAVPIGFQ NGEVEVVLSD PRHKEAVAQL LNRPARFYLA LPQAWEELFR RAYPQKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - na MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 318 K, pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PilF159-302 | [U-13C; U-15N] | 523 uM | |
2 | D2O | natural abundance | 10 % | |
3 | DSS | natural abundance | 200 uM | |
4 | Bis-TRIS | natural abundance | 50 mM | |
5 | beta-mercaptoethanol | natural abundance | 1 % | |
6 | sodium chloride | natural abundance | 200 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27852_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSSGEGQKDLKLGELLLQKGWISREALEEALVEQEKTGDLLGRILVRKGLPEEALYRALAEQKGLEFLESTEGIVPDPSAALLLLRSDALRYGAVPIGFQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GEGQKDLKLGELLLQKGWISREALEEALVEQEKTGDLLGRILVRKGLPEEALYRALAEQKGLEFLESTEGIVPDPSAALLLLRSDALRYGAVPIGFQ -------110-------120-------130-------140------ NGEVEVVLSDPRHKEAVAQLLNRPARFYLALPQAWEELFRRAYPQK |||||||||||||||||||||||||||||||||||||||||||||| NGEVEVVLSDPRHKEAVAQLLNRPARFYLALPQAWEELFRRAYPQK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 903 | 857 | 94.9 |
13C chemical shifts | 669 | 647 | 96.7 |
15N chemical shifts | 161 | 147 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 297 | 290 | 97.6 |
13C chemical shifts | 292 | 286 | 97.9 |
15N chemical shifts | 138 | 135 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 606 | 567 | 93.6 |
13C chemical shifts | 377 | 361 | 95.8 |
15N chemical shifts | 23 | 12 | 52.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 93 | 86 | 92.5 |
13C chemical shifts | 93 | 90 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 40 | 80.0 |
13C chemical shifts | 48 | 38 | 79.2 |
15N chemical shifts | 2 | 2 | 100.0 |