NMR solution structure of the CARD9 CARD
MSDYENDDEC WSVLEGFRVT LTSVIDPSRI TPYLRQCKVL NPDDEEQVLS DPNLVIRKRK VGVLLDILQR TGHKGYVAFL ESLELYYPQL YKKVTGK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.3 % (1127 of 1170) | 96.1 % (587 of 611) | 96.7 % (444 of 459) | 96.0 % (96 of 100) |
Backbone | 96.7 % (553 of 572) | 96.4 % (187 of 194) | 97.2 % (278 of 286) | 95.7 % (88 of 92) |
Sidechain | 96.2 % (664 of 690) | 95.9 % (400 of 417) | 96.6 % (256 of 265) | 100.0 % (8 of 8) |
Aromatic | 92.9 % (78 of 84) | 92.9 % (39 of 42) | 92.7 % (38 of 41) | 100.0 % (1 of 1) |
Methyl | 96.7 % (116 of 120) | 96.7 % (58 of 60) | 96.7 % (58 of 60) |
1. entity 1
MSDYENDDEC WSVLEGFRVT LTSVIDPSRI TPYLRQCKVL NPDDEEQVLS DPNLVIRKRK VGVLLDILQR TGHKGYVAFL ESLELYYPQL YKKVTGKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-13C; U-15N] CARD9 CARD, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | CARD9 CARD | [U-13C; U-15N] | 0.4 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-13C; U-15N] CARD9 CARD, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | CARD9 CARD | [U-13C; U-15N] | 0.4 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.4 mM [U-13C; U-15N] CARD9 CARD, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | CARD9 CARD | [U-13C; U-15N] | 0.4 mM |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 7.0, Details 0.40 mM [U-13C; U-15N] CARD9 CARD, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CARD9 CARD | [U-13C; U-15N] | 0.40 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30492_6e26.nef |
Input source #2: Coordindates | 6e26.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 97 | 0 | 0 | 100.0 |
Content subtype: combined_30492_6e26.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
71 | THR | HG1 | 5.456 |
82 | SER | HG | 4.867 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 611 | 592 | 96.9 |
13C chemical shifts | 459 | 449 | 97.8 |
15N chemical shifts | 106 | 96 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 194 | 189 | 97.4 |
13C chemical shifts | 194 | 190 | 97.9 |
15N chemical shifts | 92 | 88 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 417 | 403 | 96.6 |
13C chemical shifts | 265 | 259 | 97.7 |
15N chemical shifts | 14 | 8 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 60 | 98.4 |
13C chemical shifts | 61 | 60 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 39 | 92.9 |
13C chemical shifts | 41 | 38 | 92.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..DYE.DDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK || || ||| | ||| ||| | || || || || ||| ||| || | ||||||||||| ||||||||| .............LE.FR.TLT.V.....ITP.LRQ.K..NP..EE..LS.....IR.RKV.VLL..LQ..G.KGYVAFLESLE.YYPQLYKKV --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGK |||||||||||||||||| |||| |||||| ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| .....NDDECWSVLEGFRVTLTS...PSRI.PYLRQC.VLNPDDEEQVLSD..LVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTG --------10--------20--------30--------40--------50--------60--------70--------80--------90------