NMR structure of UB2H, regulatory domain of PBP1b from E. coli
MGSSHHHHHH SSGLVPRGSH MGRMVNLEPD MTISKNEMVK LLEATQYRQV SKMTRPGEFT VQANSIEMIR RPFDFPDSKE GQVRARLTFD GDHLATIVNM ENNRQFGFFR LDPR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.0 % (1046 of 1341) | 76.1 % (537 of 706) | 81.2 % (419 of 516) | 75.6 % (90 of 119) |
Backbone | 82.3 % (553 of 672) | 81.3 % (187 of 230) | 82.9 % (277 of 334) | 82.4 % (89 of 108) |
Sidechain | 75.2 % (583 of 775) | 73.5 % (350 of 476) | 80.6 % (232 of 288) | 9.1 % (1 of 11) |
Aromatic | 63.6 % (70 of 110) | 63.6 % (35 of 55) | 63.6 % (35 of 55) | |
Methyl | 93.5 % (86 of 92) | 93.5 % (43 of 46) | 93.5 % (43 of 46) |
1. entity 1
MGSSHHHHHH SSGLVPRGSH MGRMVNLEPD MTISKNEMVK LLEATQYRQV SKMTRPGEFT VQANSIEMIR RPFDFPDSKE GQVRARLTFD GDHLATIVNM ENNRQFGFFR LDPRSolvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 700 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 950 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O and 10% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 500 uM [U-13C; U-15N] UB2H, 450 uM [U-99% 15N] UB2H, 100 uM not label UB2H_Lys-Oxyl, 90% H2O and 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UB2H double label | [U-13C; U-15N] | 500 (±5.0) uM | |
2 | UB2H single label | [U-99% 15N] | 450 (±5.0) uM | |
3 | UB2H_Lys-Oxyl | natural abundance | 100 (±5.0) uM | |
4 | Tris/HCl | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 200 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_34246_6fzk.nef |
Input source #2: Coordindates | 6fzk.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--90-------100-------110-------120-------130-------140-------150-------160-------170-------180------ MGSSHHHHHHSSGLVPRGSHMGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -190-------200 ENNRQFGFFRLDPR |||||||||||||| ENNRQFGFFRLDPR -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_34246_6fzk.nef
Assigned chemical shifts
--90-------100-------110-------120-------130-------140-------150-------160-------170-------180------ MGSSHHHHHHSSGLVPRGSHMGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNM ||| | |||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| ............GLV.R..HMGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTV..NSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNM -190-------200 ENNRQFGFFRLDPR |||||||||||||| ENNRQFGFFRLDPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 516 | 408 | 79.1 |
1H chemical shifts | 706 | 517 | 73.2 |
15N chemical shifts | 130 | 85 | 65.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 228 | 180 | 78.9 |
1H chemical shifts | 230 | 178 | 77.4 |
15N chemical shifts | 108 | 85 | 78.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 288 | 228 | 79.2 |
1H chemical shifts | 476 | 339 | 71.2 |
15N chemical shifts | 22 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 54 | 42 | 77.8 |
1H chemical shifts | 54 | 44 | 81.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 55 | 35 | 63.6 |
1H chemical shifts | 55 | 35 | 63.6 |
Distance restraints
--90-------100-------110-------120-------130-------140-------150-------160-------170-------180------ MGSSHHHHHHSSGLVPRGSHMGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNM || ||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| ...................HM.RMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTV..NSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNM -190-------200 ENNRQFGFFRLDPR |||||||||||||| ENNRQFGFFRLDPR