Cadmium(II) form of full-length metallothionein from Pseudomonas fluorescens Q2-87 (PflQ2 MT)
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | metal coordination | sing | 1:CYS7:SG | 2:CD1:CD |
2 | metal coordination | sing | 1:CYS32:SG | 2:CD1:CD |
3 | metal coordination | sing | 1:HIS36:NE2 | 2:CD1:CD |
4 | metal coordination | sing | 1:CYS49:SG | 2:CD1:CD |
5 | metal coordination | sing | 1:CYS10:SG | 2:CD1:CD |
6 | metal coordination | sing | 1:CYS42:SG | 2:CD1:CD |
7 | metal coordination | sing | 1:CYS47:SG | 2:CD1:CD |
8 | metal coordination | sing | 1:CYS49:SG | 2:CD1:CD |
9 | metal coordination | sing | 1:CYS10:SG | 2:CD1:CD |
10 | metal coordination | sing | 1:CYS12:SG | 2:CD1:CD |
11 | metal coordination | sing | 1:CYS28:SG | 2:CD1:CD |
12 | metal coordination | sing | 1:CYS42:SG | 2:CD1:CD |
13 | metal coordination | sing | 1:CYS5:SG | 2:CD1:CD |
14 | metal coordination | sing | 1:CYS10:SG | 2:CD1:CD |
15 | metal coordination | sing | 1:CYS28:SG | 2:CD1:CD |
16 | metal coordination | sing | 1:CYS32:SG | 2:CD1:CD |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.7 % (829 of 857) | 98.0 % (442 of 451) | 95.1 % (310 of 326) | 96.2 % (77 of 80) |
Backbone | 96.4 % (451 of 468) | 98.7 % (157 of 159) | 94.9 % (225 of 237) | 95.8 % (69 of 72) |
Sidechain | 97.6 % (453 of 464) | 97.6 % (285 of 292) | 97.6 % (160 of 164) | 100.0 % (8 of 8) |
Aromatic | 81.8 % (36 of 44) | 81.8 % (18 of 22) | 81.8 % (18 of 22) | |
Methyl | 100.0 % (48 of 48) | 100.0 % (24 of 24) | 100.0 % (24 of 24) |
1. entity 1
NELRCGCPDC HCKVDPERVF NHDGEAYCSQ ACAEQHPNGE PCPAPDCHCE RSGKVGGRDI TNNQLDEALE ETFPASDPIS PSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 1.5 mM metallothionein, 6 mM U-113CD cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1.5 (±0.1) mM | |
6 | cadmium ion | U-113CD | 6 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 150.928 Hz | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 600.23 Hz | external | direct | 1.0 |
15N | DSS | methyl protons | 60.82078 Hz | external | indirect | 0.1013291 |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 700 MHz CRYO TXI inverse triple-resonance (1H; 13C; 15N) with an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 700 MHz CRYO TXI inverse triple-resonance (1H; 13C; 15N) with an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker AvanceII - 500 MHz CRYO 5 mm BBO probe with an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 7.4 (±0.2), Details 1.5 mM metallothionein, 6 mM U-113CD cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1.5 (±0.1) mM | |
6 | cadmium ion | U-113CD | 6 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker AvanceII - 500 MHz CRYO 5 mm BBO probe with an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 7.4 (±0.2), Details 1.5 mM metallothionein, 6 mM U-113CD cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | metallothionein | natural abundance | 1.5 (±0.1) mM | |
6 | cadmium ion | U-113CD | 6 (±0.1) mM | |
7 | TRIS | [U-2H] | 50 (±1.0) mM | |
8 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Bruker Avance - 600 MHz CRYO TCI inverse triple-resonance (1H; 13C; 15N) probe with a cold 13C-Channel and an actively shielded z-gradient coil
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.4 (±0.2), Details 0.5 mM [U-13C; U-15N] metallothionein, 2 mM cadmium ion, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | metallothionein | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | cadmium ion | natural abundance | 2 (±0.1) mM | |
3 | TRIS | [U-2H] | 50 (±1.0) mM | |
4 | sodium chloride | natural abundance | 50 (±1.0) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_34282_6grv.nef |
Input source #2: Coordindates | 6grv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:5:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:7:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:10:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:12:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:28:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:28:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:32:CYS:SG | 2:4:CD:CD | unknown | unknown | n/a |
1:32:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
1:36:HIS:NE2 | 2:1:CD:CD | unknown | unknown | n/a |
1:42:CYS:SG | 2:3:CD:CD | unknown | unknown | n/a |
1:42:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:47:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:49:CYS:SG | 2:2:CD:CD | unknown | unknown | n/a |
1:49:CYS:SG | 2:1:CD:CD | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CD | CADMIUM ION | None |
B | 2 | CD | CADMIUM ION | None |
B | 3 | CD | CADMIUM ION | None |
B | 4 | CD | CADMIUM ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPISP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPISP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 81 | 0 | 0 | 100.0 |
Content subtype: combined_34282_6grv.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPISP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPISP
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
11 | HIS | ND1 | 201.32 |
11 | HIS | NE2 | 175.972 |
22 | HIS | ND1 | 203.573 |
22 | HIS | NE2 | 175.53 |
36 | HIS | HD1 | 13.33 |
36 | HIS | ND1 | 173.925 |
36 | HIS | NE2 | 225.689 |
48 | HIS | ND1 | 182.279 |
48 | HIS | NE2 | 174.791 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 451 | 440 | 97.6 |
13C chemical shifts | 326 | 309 | 94.8 |
15N chemical shifts | 84 | 77 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 159 | 156 | 98.1 |
13C chemical shifts | 162 | 149 | 92.0 |
15N chemical shifts | 72 | 69 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 292 | 284 | 97.3 |
13C chemical shifts | 164 | 160 | 97.6 |
15N chemical shifts | 12 | 8 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 24 | 100.0 |
13C chemical shifts | 24 | 24 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 18 | 81.8 |
13C chemical shifts | 22 | 18 | 81.8 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPISP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPIS --------10--------20--------30--------40--------50--------60--------70--------80
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80- NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERSGKVGGRDITNNQLDEALEETFPASDPISP |||||||||||||||||||||||||||||||||||||||||||||||||| |||||| NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCE.........................SDPISP