Solution structure and 1H, 13C and 15N chemical shift assignments for the complex of VPS29 with VARP 687-747
GSPEFGTRDR MLVLVLGDLH IPHRCNSLPA KFKKLLVPGK IQHILCTGNL CTKESYDYLK TLAGDVHIVR GDFDENLNYP EQKVVTVGQF KIGLIHGHQV IPWGDMASLA LLQRQFDVDI LISGHTHKFE AFEHENKFYI NPGSATGAYN ALETNIIPSF VLMDIQASTV VTYVYQLIGD DVKVERIEYK KS
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | na | sing | 2:CYS25:SG | 3:ZN1:ZN |
2 | na | sing | 2:CYS29:SG | 3:ZN1:ZN |
3 | na | sing | 2:CYS31:SG | 3:ZN1:ZN |
4 | na | sing | 2:CYS34:SG | 3:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 75.5 % (2203 of 2918) | 78.5 % (1180 of 1504) | 68.0 % (779 of 1146) | 91.0 % (244 of 268) |
Backbone | 79.9 % (1190 of 1490) | 93.6 % (479 of 512) | 65.0 % (480 of 739) | 96.7 % (231 of 239) |
Sidechain | 73.9 % (1228 of 1661) | 70.7 % (701 of 992) | 80.3 % (514 of 640) | 44.8 % (13 of 29) |
Aromatic | 57.0 % (130 of 228) | 69.3 % (79 of 114) | 43.8 % (49 of 112) | 100.0 % (2 of 2) |
Methyl | 93.6 % (279 of 298) | 93.3 % (139 of 149) | 94.0 % (140 of 149) |
1. entity 1
GSPEFGTRDR MLVLVLGDLH IPHRCNSLPA KFKKLLVPGK IQHILCTGNL CTKESYDYLK TLAGDVHIVR GDFDENLNYP EQKVVTVGQF KIGLIHGHQV IPWGDMASLA LLQRQFDVDI LISGHTHKFE AFEHENKFYI NPGSATGAYN ALETNIIPSF VLMDIQASTV VTYVYQLIGD DVKVERIEYK KS2. entity 2
GPLGSTEEDL EDAEDTVSAA DPEFCHPLCQ CPKCAPAQKR LAKVPASGLG VNVTSQDGSS WSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
2 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
3 | TRIS | [U-2H] | 20 mM | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 283 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 275 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 283 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 275 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
12 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
13 | TRIS | [U-2H] | 20 mM | |
14 | sodium chloride | natural abundance | 200 mM | |
15 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM VPS29, 0.45 mM [U-98% 13C; U-98% 15N] VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPS29 | natural abundance | 0.45 (±0.15) mM | |
17 | VARP 692-746 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
18 | TRIS | [U-2H] | 20 mM | |
19 | sodium chloride | natural abundance | 200 mM | |
20 | DTT | [U-2H] | 1 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 0.45 mM [U-98% 13C; U-98% 15N] VPS29, 0.45 mM VARP 692-746, 20 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM [U-2H] DTT, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPS29 | [U-98% 13C; U-98% 15N] | 0.45 (±0.15) mM | |
7 | VARP 692-746 | natural abundance | 0.45 (±0.15) mM | |
8 | TRIS | [U-2H] | 20 mM | |
9 | sodium chloride | natural abundance | 200 mM | |
10 | DTT | [U-2H] | 1 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Non-standard residues
NoneContent subtype: bmr34461_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSPEFGTRDRMLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQV |||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PEFGTRDRMLVLVLGDLHIPHRCNSL.AKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQV -------110-------120-------130-------140-------150-------160-------170-------180-------190-- IPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS
--------10--------20--------30--------40--------50--------60- GPLGSTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSW |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PLGSTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSW
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1175 | 915 | 77.9 |
13C chemical shifts | 899 | 601 | 66.9 |
15N chemical shifts | 207 | 182 | 87.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 391 | 370 | 94.6 |
13C chemical shifts | 384 | 186 | 48.4 |
15N chemical shifts | 184 | 175 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 784 | 545 | 69.5 |
13C chemical shifts | 515 | 415 | 80.6 |
15N chemical shifts | 23 | 7 | 30.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 124 | 118 | 95.2 |
13C chemical shifts | 124 | 119 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 70 | 69.3 |
13C chemical shifts | 100 | 39 | 39.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 329 | 250 | 76.0 |
13C chemical shifts | 247 | 148 | 59.9 |
15N chemical shifts | 61 | 57 | 93.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 121 | 109 | 90.1 |
13C chemical shifts | 122 | 59 | 48.4 |
15N chemical shifts | 55 | 52 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 208 | 141 | 67.8 |
13C chemical shifts | 125 | 89 | 71.2 |
15N chemical shifts | 6 | 5 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 23 | 82.1 |
13C chemical shifts | 28 | 23 | 82.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 3 | 23.1 |
13C chemical shifts | 12 | 2 | 16.7 |
15N chemical shifts | 1 | 1 | 100.0 |