BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	69.0 % (1006 of 1459)	67.0 % (512 of 764)	71.2 % (398 of 559)	70.6 % (96 of 136)
Backbone	76.6 % (570 of 744)	74.2 % (187 of 252)	78.4 % (290 of 370)	76.2 % (93 of 122)
Sidechain	63.7 % (532 of 835)	63.5 % (325 of 512)	66.0 % (204 of 309)	21.4 % (3 of 14)
Aromatic	27.6 % (27 of 98)	55.1 % (27 of 49)	0.0 % (0 of 48)	0.0 % (0 of 1)
Methyl	93.0 % (106 of 114)	94.7 % (54 of 57)	91.2 % (52 of 57)

1. EDC3-LSm

GAMGMSVADF YGSNVEVLLN NDSKARGVIT NFDSSNSILQ LRLANDSTKS IVTKDIKDLR ILPKNEIMPK NGTKSPSTNS TKLKSAETYS SKNKWSMDCD EEFDFAANLE KFDKKQVFAE FREKD

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5

#	Name	Isotope labeling	Concentration
1	EDC3-LSm	[U-100% 15N]	0.7 mM
2	NaPO4	natural abundance	50 mM
3	imidazole	natural abundance	10 mM
4	NaCl	natural abundance	150 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	TMS	methyl carbons	2.6 ppm	na	indirect	1.0
¹H	TMS	methyl protons	0.0 ppm	na	indirect	1.0
¹⁵N	TMS	nitrogen	0.0 ppm	na	indirect	1.0

Referencing offset: -0.11 ppm, Outliers: 3 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	TMS	methyl carbons	2.6 ppm	na	indirect	1.0
¹H	TMS	methyl protons	0.0 ppm	na	indirect	1.0
¹⁵N	TMS	nitrogen	0.0 ppm	na	indirect	1.0

Referencing offset: -0.11 ppm, Outliers: 3 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	TMS	methyl carbons	2.6 ppm	na	indirect	1.0
¹H	TMS	methyl protons	0.0 ppm	na	indirect	1.0
¹⁵N	TMS	nitrogen	0.0 ppm	na	indirect	1.0

Referencing offset: -0.04 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	TMS	methyl carbons	2.6 ppm	na	indirect	1.0
¹H	TMS	methyl protons	0.0 ppm	na	indirect	1.0
¹⁵N	TMS	nitrogen	0.0 ppm	na	indirect	1.0

Referencing offset: 0.62 ppm, Outliers: 3 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 4A53, Strand ID: A Detail

Release date

2012-01-22

Citation

The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex
Fromm, S.A., Truffault, V., Kamenz, J., Braun, J.E., Hoffmann, N.A., Izaurralde, E., Sprangers, R.
EMBO J. (2012), 31, 279-290, PubMed 22085934 , DOI 10.1038/emboj.2011.408 , Abstract

Related entities 1. EDC3-LSm domain, : 1 : 2 : 1 entities Detail

Interaction partners 1. EDC3-LSm domain, : 2 interactors Detail

More details for 2 interactors identified by 1 citations

Experiments performed 1 experiments Detail

NMR combined restraints 6 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_18041_4a53.nef
Input source #2: Coordindates	4a53.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

------------10--------20--------30--------40--------50--------60--------70--------80--------90------
GAMGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMDCD
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GAMGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMDCD
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

-100-------110-------120-
EEFDFAANLEKFDKKQVFAEFREKD
|||||||||||||||||||||||||
EEFDFAANLEKFDKKQVFAEFREKD
-------110-------120-----

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	125	0	0	100.0

Content subtype: combined_18041_4a53.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	969		80.0 (chain: A, length: 125)
1	Distance restraints	CNS/XPLOR_distance_constraints_5	Warning	339 (1)	noe	44.8 (chain: A, length: 125)
2	Distance restraints	CNS/XPLOR_distance_constraints_4	Warning	28 (1)	hbond	25.6 (chain: A, length: 125)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_2	OK	118 (118)	.	57.6 (chain: A, length: 125)
2	Dihedral angle restraints	CNS/XPLOR_dihedral_6	OK	50 (50)	.	30.4 (chain: A, length: 125)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 125, Sequence coverage: 80.0%
- Total number of assignments
  - ¹H chemical shifts: 490
  - ¹³C chemical shifts: 386
  - ¹⁵N chemical shifts: 93
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	764	490	64.1
¹³C chemical shifts	559	386	69.1
¹⁵N chemical shifts	140	93	66.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	252	179	71.0
¹³C chemical shifts	250	186	74.4
¹⁵N chemical shifts	122	90	73.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	512	311	60.7
¹³C chemical shifts	309	200	64.7
¹⁵N chemical shifts	18	3	16.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	61	53	86.9
¹³C chemical shifts	61	52	85.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	49	27	55.1
¹³C chemical shifts	48	0	0.0
¹⁵N chemical shifts	1	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_5
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 125, Sequence coverage: 44.8%
- Total number of restraints: 339
- Weight of restraints: 1.0 (339)
- Potential type of restraints: square-well-parabolic (339)
- Range of distance target values: 1.35, 7.75 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_4
  - Status: Warning
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 125, Sequence coverage: 25.6%
  - Total number of restraints: 28
  - Weight of restraints: 1.0 (28)
  - Potential type of restraints: square-well-parabolic (28)
  - Range of distance target values: 2.25, 2.25 (Å)
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 125, Sequence coverage: 57.6%
- Total number of restraints: 118
- Total number of restraints per polymer type: 118
- Weight of restraints: 1.0 (118)
- Potential type of restraints: square-well-parabolic (118)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A
- Saveframe: CNS/XPLOR_dihedral_6
  - Status: OK
  - Experiment type: .
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 125, Sequence coverage: 30.4%
  - Total number of restraints: 50
  - Total number of restraints per polymer type: 50
  - Weight of restraints: 1.0 (50)
  - Potential type of restraints: square-well-parabolic (50)
  - Plot of Chi1-Chi2 angle restraints
  - Dihedral angle restraints per residue

Keywords Edc3-LSm domain

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.709 seconds)

BMRB: 18041

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. EDC3-LSm domain, : 1 : 2 : 1 entities Detail

Interaction partners 1. EDC3-LSm domain, : 2 interactors Detail

Experiments performed 1 experiments Detail

Instrument

Sample

NMR combined restraints 6 contents Detail