CohA2
GSASVKNETV KLSVGTVSGN PGDTVKVPVT ISQVSTPVGL ICMDISYDAS KFTVKDVLPN TDLVKDTDNY SFIVNTSTPG KISITFTDPT LANYPISVDG ILAYLDFIIN SNATAGDSAL TVDPATLIVA DENDKDIKDA ASNGKITVTG SAPTS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.5 % (1631 of 1655) | 98.9 % (826 of 835) | 98.0 % (650 of 663) | 98.7 % (155 of 157) |
Backbone | 98.5 % (898 of 912) | 98.7 % (307 of 311) | 98.2 % (447 of 455) | 98.6 % (144 of 146) |
Sidechain | 98.8 % (877 of 888) | 99.0 % (519 of 524) | 98.3 % (347 of 353) | 100.0 % (11 of 11) |
Aromatic | 94.4 % (68 of 72) | 94.4 % (34 of 36) | 94.4 % (34 of 36) | |
Methyl | 97.7 % (213 of 218) | 98.2 % (107 of 109) | 97.2 % (106 of 109) |
1. CohA2
GSASVKNETV KLSVGTVSGN PGDTVKVPVT ISQVSTPVGL ICMDISYDAS KFTVKDVLPN TDLVKDTDNY SFIVNTSTPG KISITFTDPT LANYPISVDG ILAYLDFIIN SNATAGDSAL TVDPATLIVA DENDKDIKDA ASNGKITVTG SAPTSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CohA2 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr18188_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSASVKNETVKLSVGTVSGNPGDTVKVPVTISQVSTPVGLICMDISYDASKFTVKDVLPNTDLVKDTDNYSFIVNTSTPGKISITFTDPTLANYPISVDG ||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSASVKNET.KLSVGTVSGNPGDTVKVPVTISQVSTPVGLICMDISYDASKFTVKDVLPNTDLVKDTDNYSFIVNTSTPGKISITFTDPTLANYPISVDG -------110-------120-------130-------140-------150----- ILAYLDFIINSNATAGDSALTVDPATLIVADENDKDIKDAASNGKITVTGSAPTS ||||||||||||||||||||||||||||||||||||| |||||||||||||||| ILAYLDFIINSNATAGDSALTVDPATLIVADENDKDI..AASNGKITVTGSAPTS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 835 | 810 | 97.0 |
13C chemical shifts | 663 | 640 | 96.5 |
15N chemical shifts | 157 | 151 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 311 | 302 | 97.1 |
13C chemical shifts | 310 | 299 | 96.5 |
15N chemical shifts | 146 | 140 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 524 | 508 | 96.9 |
13C chemical shifts | 353 | 341 | 96.6 |
15N chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 110 | 107 | 97.3 |
13C chemical shifts | 110 | 106 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 34 | 94.4 |
13C chemical shifts | 36 | 34 | 94.4 |