The Solution Structure of the Regulatory Domain of Tyrosine Hydroxylase
NPLEAVVFEE RDGNAVLNLL FSLRGTKPSS LSRAVKVFET FEAKIHHLET RPAQRPLAGS PHLEYFVRFE VPSGDLAALL SSVRRVSDDV RSA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.5 % (916 of 1071) | 84.1 % (467 of 555) | 84.9 % (361 of 425) | 96.7 % (88 of 91) |
Backbone | 96.9 % (529 of 546) | 97.8 % (180 of 184) | 96.4 % (265 of 275) | 96.6 % (84 of 87) |
Sidechain | 77.2 % (474 of 614) | 77.4 % (287 of 371) | 76.6 % (183 of 239) | 100.0 % (4 of 4) |
Aromatic | 17.5 % (14 of 80) | 35.0 % (14 of 40) | 0.0 % (0 of 40) | |
Methyl | 96.6 % (112 of 116) | 96.6 % (56 of 58) | 96.6 % (56 of 58) |
1. RDTyrH65-159
NPLEAVVFEE RDGNAVLNLL FSLRGTKPSS LSRAVKVFET FEAKIHHLET RPAQRPLAGS PHLEYFVRFE VPSGDLAALL SSVRRVSDDV RSASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | D2O | [U-100% 2H] | 5 % | |
4 | H2O | [U-100% 2H] | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | RDTyrH65-159 | natural abundance | 0.9 mM | |
10 | RDTyrH65-159 | [U-2H; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | D2O | [U-100% 2H] | 5 % | |
13 | H2O | [U-100% 2H] | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
15 | sodium phosphate | natural abundance | 50 mM | |
16 | D2O | [U-100% 2H] | 5 % | |
17 | Pf1 phage | natural abundance | 8 mg/mL | |
18 | H2O | [U-100% 2H] | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | D2O | [U-100% 2H] | 5 % | |
4 | H2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | D2O | [U-100% 2H] | 5 % | |
4 | H2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | RDTyrH65-159 | natural abundance | 0.9 mM | |
10 | RDTyrH65-159 | [U-2H; U-15N] | 0.9 mM | |
11 | sodium phosphate | natural abundance | 50 mM | |
12 | D2O | [U-100% 2H] | 5 % | |
13 | H2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | RDTyrH65-159 | [U-95% 13C; U-95% 15N] | 1.0-1.2 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | h2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
15 | sodium phosphate | natural abundance | 50 mM | |
16 | D2O | [U-100% 2H] | 5 % | |
17 | Pf1 phage | natural abundance | 8 mg/mL | |
18 | H2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | D2O | [U-100% 2H] | 5 % | |
4 | H2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | D2O | [U-100% 2H] | 5 % | |
4 | H2O | [U-100% 2H] | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 7, Details 1 M leupeptin and 1 M pepstatin A were added as protease inhibitor
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RDTyrH65-159 | [U-95% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | D2O | [U-100% 2H] | 5 % | |
4 | H2O | [U-100% 2H] | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_19482_2mda.nef |
Input source #2: Coordindates | 2mda.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA --------10--------20--------30--------40--------50--------60--------70--------80--------90-----
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA --------10--------20--------30--------40--------50--------60--------70--------80--------90-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 95 | 0 | 0 | 100.0 |
B | B | 95 | 0 | 0 | 100.0 |
Content subtype: combined_19482_2mda.nef
Assigned chemical shifts
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA |||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..NPLEAVVFEERDGNAVLNLLFSLRGT..SSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 565 | 460 | 81.4 |
13C chemical shifts | 432 | 358 | 82.9 |
15N chemical shifts | 101 | 88 | 87.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 188 | 180 | 95.7 |
13C chemical shifts | 190 | 177 | 93.2 |
15N chemical shifts | 88 | 84 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 280 | 74.3 |
13C chemical shifts | 242 | 181 | 74.8 |
15N chemical shifts | 13 | 4 | 30.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 55 | 94.8 |
13C chemical shifts | 58 | 55 | 94.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 14 | 35.0 |
13C chemical shifts | 40 | 0 | 0.0 |
Distance restraints
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA |||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..NPLEAVVFEERDGNAVLNLLFSLRGT..SSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA |||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..NPLEAVVFEERDGNAVLNLLFSLRGT..SSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA |||||||||||||||||||||||||| |||||||||| ||||||||||||||||||| |||||||||||||||||||||||||||||||||| ..NPLEAVVFEERDGNAVLNLLFSLRGT..SSLSRAVKVF.TFEAKIHHLETRPAQRPLA.SPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA |||||||||||||||||||||||||| |||||||||| ||||||||||||||||||| |||||||||||||||||||||||||||||||||| ..NPLEAVVFEERDGNAVLNLLFSLRGT..SSLSRAVKVF.TFEAKIHHLETRPAQRPLA.SPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
Dihedral angle restraints
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA ||||||||||||||||||||||| ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| ...PLEAVVFEERDGNAVLNLLFSLR...PSSLSRAVKVFETFEAKIHHLETRPAQ......PHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA ||||||||||||||||||||||| ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| ...PLEAVVFEERDGNAVLNLLFSLR...PSSLSRAVKVFETFEAKIHHLETRPAQ......PHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA
RDC restraints
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA |||||| || | ||||| ||| | ||| || ||||||| | ||| | | |||| |||| ||||||| ||| || ....LEAVVF.ER.G.AVLNL.FSL.G....SLS....VF..FEAKIHH.E...AQR....S....Y..RFEV.SGDL...LSSVRRV.DDV.SA
----70--------80--------90-------100-------110-------120-------130-------140-------150--------- PGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRAVKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSA |||||| || | ||||| ||| | ||| || ||||||| | ||| | | |||| |||| ||||||| ||| || ....LEAVVF.ER.G.AVLNL.FSL.G....SLS....VF..FEAKIHH.E...AQR....S....Y..RFEV.SGDL...LSSVRRV.DDV.SA