Mfd_RID
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.2 % (756 of 838) | 91.1 % (388 of 426) | 91.9 % (305 of 332) | 78.8 % (63 of 80) |
Backbone | 90.7 % (408 of 450) | 91.3 % (146 of 160) | 92.2 % (200 of 217) | 84.9 % (62 of 73) |
Sidechain | 89.2 % (404 of 453) | 89.5 % (238 of 266) | 92.2 % (166 of 180) | 0.0 % (0 of 7) |
Aromatic | 66.7 % (40 of 60) | 66.7 % (20 of 30) | 66.7 % (20 of 30) | |
Methyl | 100.0 % (100 of 100) | 100.0 % (50 of 50) | 100.0 % (50 of 50) |
1. entity 1
RNLAELHIGQ PVVHLEHGVG RYAGMTTLEA GGITGEYLML TYANDAKLYV PVSSLHLISR YAGGAEENAP LHKLGGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details [NaCl]: 137 mM [KCl]: 2.7 mM [Na2HPO4]: 10 mM [KH2PO4]: 1.8 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RID | [U-100% 13C; U-100% 15N] | 600 uM | |
2 | 1x PBS buffer | natural abundance | 152 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50219_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------ RNLAELHIGQPVVHLEHGVGRYAGMTTLEAGGITGEYLMLTYANDAKLYVPVSSLHLISRYAGGAEENAPLHKLGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RNLAELHIGQPVVHLEHGVGRYAGMTTLEAGGITGEYLMLTYANDAKLYVPVSSLHLISRYAGGAEENAPLHKLGG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 426 | 388 | 91.1 |
13C chemical shifts | 332 | 303 | 91.3 |
15N chemical shifts | 80 | 63 | 78.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 160 | 146 | 91.2 |
13C chemical shifts | 152 | 135 | 88.8 |
15N chemical shifts | 73 | 63 | 86.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 266 | 242 | 91.0 |
13C chemical shifts | 180 | 168 | 93.3 |
15N chemical shifts | 7 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 50 | 96.2 |
13C chemical shifts | 52 | 50 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 20 | 66.7 |
13C chemical shifts | 30 | 20 | 66.7 |