1H, 13C, 15N backbone and ILMVAT methyl group assignment of the C-terminal RecA and RBD domains of the DEAD-box RNA helicase DbpA from E.coli
GGSTDALPPI EQQFYETSSK GKIPLLQRLL SLHQPSSCVV FCNTKKDCQA VCDALNEVGQ SALSLHGDLE QRDRDQTLVR FANGSARVLV ATDVAARGLD IKSLELVVNF ELAWDPEVHV HRIGRTARAG NSGLAISFCA PEEAQRANII SDMLQIKLNW QTPPANSSIA TLEAEMATLC IDGGKKAKMR PGDVLGALTG DIGLDGADIG KIAVHPAHVY VAVRQAVAHK AWKQLQGGKI KGKTCRVRLL K
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 54.5 % (1543 of 2833) | 32.9 % (480 of 1460) | 74.1 % (810 of 1093) | 90.4 % (253 of 280) |
Backbone | 78.2 % (1162 of 1486) | 48.0 % (246 of 513) | 93.4 % (684 of 732) | 96.3 % (232 of 241) |
Sidechain | 38.0 % (599 of 1577) | 24.7 % (234 of 947) | 58.2 % (344 of 591) | 53.8 % (21 of 39) |
Aromatic | 16.9 % (22 of 130) | 24.6 % (16 of 65) | 4.8 % (3 of 62) | 100.0 % (3 of 3) |
Methyl | 90.0 % (288 of 320) | 90.0 % (144 of 160) | 90.0 % (144 of 160) |
1. entity 1
GGSTDALPPI EQQFYETSSK GKIPLLQRLL SLHQPSSCVV FCNTKKDCQA VCDALNEVGQ SALSLHGDLE QRDRDQTLVR FANGSARVLV ATDVAARGLD IKSLELVVNF ELAWDPEVHV HRIGRTARAG NSGLAISFCA PEEAQRANII SDMLQIKLNW QTPPANSSIA TLEAEMATLC IDGGKKAKMR PGDVLGALTG DIGLDGADIG KIAVHPAHVY VAVRQAVAHK AWKQLQGGKI KGKTCRVRLL KSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 250 mM | |
8 | HEPES | natural abundance | 25 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met, 1H13CG-Thr,U-1H-Tyr] | 800 uM | |
11 | Arginine | natural abundance | 25 mM | |
12 | Glutamate | natural abundance | 25 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 250 mM | |
14 | HEPES | natural abundance | 25 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met] | 800 uM | |
17 | Arginine | natural abundance | 25 mM | |
18 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 250 mM | |
8 | HEPES | natural abundance | 25 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met, 1H13CG-Thr,U-1H-Tyr] | 800 uM | |
11 | Arginine | natural abundance | 25 mM | |
12 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 250 mM | |
8 | HEPES | natural abundance | 25 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met, 1H13CG-Thr,U-1H-Tyr] | 800 uM | |
11 | Arginine | natural abundance | 25 mM | |
12 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 250 mM | |
8 | HEPES | natural abundance | 25 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met, 1H13CG-Thr,U-1H-Tyr] | 800 uM | |
11 | Arginine | natural abundance | 25 mM | |
12 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 250 mM | |
8 | HEPES | natural abundance | 25 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met, 1H13CG-Thr,U-1H-Tyr] | 800 uM | |
11 | Arginine | natural abundance | 25 mM | |
12 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 250 mM | |
14 | HEPES | natural abundance | 25 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met] | 800 uM | |
17 | Arginine | natural abundance | 25 mM | |
18 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 250 mM | |
14 | HEPES | natural abundance | 25 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met] | 800 uM | |
17 | Arginine | natural abundance | 25 mM | |
18 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 250 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | C-terminal RecA domain + RNA binding domain | [U-13C; U-15N; U-2H; 95% 1HD-Ile,Leu; 95% 1HG-Val,95% 1H,13CE-Met] | 750 uM | |
5 | Arginine | natural abundance | 25 mM | |
6 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 250 mM | |
8 | HEPES | natural abundance | 25 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met, 1H13CG-Thr,U-1H-Tyr] | 800 uM | |
11 | Arginine | natural abundance | 25 mM | |
12 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 250 mM | |
14 | HEPES | natural abundance | 25 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met] | 800 uM | |
17 | Arginine | natural abundance | 25 mM | |
18 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 250 mM | |
8 | HEPES | natural abundance | 25 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met, 1H13CG-Thr,U-1H-Tyr] | 800 uM | |
11 | Arginine | natural abundance | 25 mM | |
12 | Glutamate | natural abundance | 25 mM |
Bruker AVANCE NEO - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium chloride | natural abundance | 250 mM | |
14 | HEPES | natural abundance | 25 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | C-terminal RecA domain + RNA binding domain | [U-15N; U-2H; 95% 1H13CD-Ile,Leu; 95% 1H13CG-Val, 1H13CB-Ala, 1H13CE-Met] | 800 uM | |
17 | Arginine | natural abundance | 25 mM | |
18 | Glutamate | natural abundance | 25 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr50356_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GGSTDALPPIEQQFYETSSKGKIPLLQRLLSLHQPSSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGSARVLVATDVAARGLD ||| ||||||||||| |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| || ....DAL.PIEQQFYETSS.GKIPLLQRLLSLHQPSSCVVFCNT.KDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGSARVLVATDVAAR.LD -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 IKSLELVVNFELAWDPEVHVHRIGRTARAGNSGLAISFCAPEEAQRANIISDMLQIKLNWQTPPANSSIATLEAEMATLCIDGGKKAKMRPGDVLGALTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||| |||||||| IKSLELVVNFELAWDPEVHVHRIGRTARAGNSGLAISFCAPEEAQRANIISDMLQIKLNWQT..A.SSIATLEAEMATLCIDGGKKAKMR..DVLGALTG -------210-------220-------230-------240-------250- DIGLDGADIGKIAVHPAHVYVAVRQAVAHKAWKQLQGGKIKGKTCRVRLLK ||||||||||||||||||||||||||||||||||||||||||||||||||| DIGLDGADIGKIAVHPAHVYVAVRQAVAHKAWKQLQGGKIKGKTCRVRLLK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
31 | SER | HG | 5.375 |
61 | SER | HG | 4.889 |
64 | SER | HG | 4.476 |
77 | THR | HG1 | 5.384 |
85 | SER | HG | 5.328 |
92 | THR | HG1 | 5.129 |
137 | SER | HG | 4.493 |
151 | SER | HG | 5.153 |
171 | THR | HG1 | 5.371 |
178 | THR | HG1 | 5.197 |
199 | THR | HG1 | 4.57 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1460 | 431 | 29.5 |
13C chemical shifts | 1093 | 804 | 73.6 |
15N chemical shifts | 280 | 251 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 513 | 233 | 45.4 |
13C chemical shifts | 502 | 467 | 93.0 |
15N chemical shifts | 241 | 231 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 947 | 198 | 20.9 |
13C chemical shifts | 591 | 337 | 57.0 |
15N chemical shifts | 39 | 20 | 51.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 163 | 148 | 90.8 |
13C chemical shifts | 163 | 148 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 11 | 16.9 |
13C chemical shifts | 62 | 0 | 0.0 |
15N chemical shifts | 3 | 3 | 100.0 |