Solution Structure of Yeast Prp24-RRM2 Bound to a Fragment of U6 RNA
MTECTLWMTN FPPSYTQRNI RDLLQDINVV ALSIRLPSLR FNTSRRFAYI DVTSKEDARY CVEKLNGLKI EGYTLVTKVS NPLELEHHHH HH
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS4:SG | 1:CYS61:SG |
Polymer type: polypeptide(L) polyribonucleotide
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.4 % (1013 of 1200) | 88.3 % (551 of 624) | 77.9 % (371 of 476) | 91.0 % (91 of 100) |
Backbone | 91.1 % (556 of 610) | 92.7 % (202 of 218) | 89.1 % (271 of 304) | 94.3 % (83 of 88) |
Sidechain | 79.6 % (541 of 680) | 86.0 % (349 of 406) | 70.2 % (184 of 262) | 66.7 % (8 of 12) |
Aromatic | 33.9 % (42 of 124) | 67.7 % (42 of 62) | 0.0 % (0 of 58) | 0.0 % (0 of 4) |
Methyl | 90.0 % (99 of 110) | 90.9 % (50 of 55) | 89.1 % (49 of 55) |
1. Prp24-RRM2
MTECTLWMTN FPPSYTQRNI RDLLQDINVV ALSIRLPSLR FNTSRRFAYI DVTSKEDARY CVEKLNGLKI EGYTLVTKVS NPLELEHHHH HH2. AGAGAU
AGAGAUSolvent system 100% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | natural abundance | 300 uM | |
2 | AGAGAU | natural abundance | 3 mM | |
3 | TRIS | [U-2H] | 10 mM | |
4 | potassium chloride | natural abundance | 50 mM | |
5 | D20 | natural abundance | 100 % |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Prp24-RRM2 | [U-99% 15N] | 500 uM | |
7 | AGAGAU | natural abundance | 5 mM | |
8 | TRIS | [U-2H] | 10 mM | |
9 | potassium chloride | natural abundance | 50 mM | |
10 | D20 | natural abundance | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 uM | |
19 | AGAGAU | natural abundance | 5 mM | |
20 | TRIS | natural abundance | 10 mM | |
21 | potassium chloride | natural abundance | 50 mM | |
22 | DTT | natural abundance | 1 mM | |
23 | DSS | natural abundance | 10 uM | |
24 | H20 | natural abundance | 90 % | |
25 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 300 uM | |
27 | AGAGAU | natural abundance | 3 mM | |
28 | TRIS | natural abundance | 10 mM | |
29 | potassium chloride | natural abundance | 50 mM | |
30 | DTT | natural abundance | 1 mM | |
31 | DMPC/DHPC 3:1 | natural abundance | 6.5 % | |
32 | H20 | natural abundance | 90 % | |
33 | D20 | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 uM | |
19 | AGAGAU | natural abundance | 5 mM | |
20 | TRIS | natural abundance | 10 mM | |
21 | potassium chloride | natural abundance | 50 mM | |
22 | DTT | natural abundance | 1 mM | |
23 | DSS | natural abundance | 10 uM | |
24 | H20 | natural abundance | 90 % | |
25 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Prp24-RRM2 | [U-99% 15N] | 500 uM | |
7 | AGAGAU | natural abundance | 5 mM | |
8 | TRIS | [U-2H] | 10 mM | |
9 | potassium chloride | natural abundance | 50 mM | |
10 | D20 | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Prp24-RRM2 | [U-99% 15N] | 500 uM | |
7 | AGAGAU | natural abundance | 5 mM | |
8 | TRIS | [U-2H] | 10 mM | |
9 | potassium chloride | natural abundance | 50 mM | |
10 | D20 | natural abundance | 100 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Prp24-RRM2 | [U-99% 15N] | 500 uM | |
7 | AGAGAU | natural abundance | 5 mM | |
8 | TRIS | [U-2H] | 10 mM | |
9 | potassium chloride | natural abundance | 50 mM | |
10 | D20 | natural abundance | 100 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | natural abundance | 300 uM | |
2 | AGAGAU | natural abundance | 3 mM | |
3 | TRIS | [U-2H] | 10 mM | |
4 | potassium chloride | natural abundance | 50 mM | |
5 | D20 | natural abundance | 100 % |
Varian DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian DMX - 750 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 300 uM | |
27 | AGAGAU | natural abundance | 3 mM | |
28 | TRIS | natural abundance | 10 mM | |
29 | potassium chloride | natural abundance | 50 mM | |
30 | DTT | natural abundance | 1 mM | |
31 | DMPC/DHPC 3:1 | natural abundance | 6.5 % | |
32 | H20 | natural abundance | 90 % | |
33 | D20 | natural abundance | 10 % |
Varian DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
12 | AGAGAU | natural abundance | 5 mM | |
13 | TRIS | natural abundance | 10 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | H20 | natural abundance | 90 % | |
17 | D20 | natural abundance | 10 % |
Varian DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 300 uM | |
27 | AGAGAU | natural abundance | 3 mM | |
28 | TRIS | natural abundance | 10 mM | |
29 | potassium chloride | natural abundance | 50 mM | |
30 | DTT | natural abundance | 1 mM | |
31 | DMPC/DHPC 3:1 | natural abundance | 6.5 % | |
32 | H20 | natural abundance | 90 % | |
33 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16230_2kh9.nef |
Input source #2: Coordindates | 2kh9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90--
-50--- AGAGAU |||||| AGAGAU ------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
B | B | 6 | 0 | 0 | 100.0 |
Content subtype: combined_16230_2kh9.nef
Assigned chemical shifts
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHH ----120-------130-------140-------150-------160-------170-------180-------190-------200-
-50--- AGAGAU |||||| AGAGAU
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 436 | 345 | 79.1 |
1H chemical shifts | 575 | 501 | 87.1 |
15N chemical shifts | 104 | 91 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 184 | 163 | 88.6 |
1H chemical shifts | 182 | 168 | 92.3 |
15N chemical shifts | 88 | 83 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 252 | 182 | 72.2 |
1H chemical shifts | 393 | 333 | 84.7 |
15N chemical shifts | 16 | 8 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 57 | 49 | 86.0 |
1H chemical shifts | 57 | 49 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 48 | 0 | 0.0 |
1H chemical shifts | 49 | 31 | 63.3 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 40 | 22 | 55.0 |
1H chemical shifts | 49 | 43 | 87.8 |
15N chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 30 | 22 | 73.3 |
1H chemical shifts | 36 | 33 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 10 | 0 | 0.0 |
1H chemical shifts | 13 | 10 | 76.9 |
15N chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 8 | 0 | 0.0 |
1H chemical shifts | 8 | 8 | 100.0 |
Distance restraints
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLE ----120-------130-------140-------150-------160-------170-------180-------190-------
-50--- AGAGAU |||||| AGAGAU
Dihedral angle restraints
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH ||||||| |||||||||||||||||||| |||||||| ||||||||||||||||||||| |||| ||||||||||| ....TLWMTNF.PSYTQRNIRDLLQDINVVAL.IRLPSLRF...RRFAYIDVTSKEDARYCVEKL..LKIE.YTLVTKVSNPL ----120-------130-------140-------150-------160-------170-------180-------190------
-50--- AGAGAU |||||| AGAGAU
RDC restraints
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH ||||||||| |||||||||||||| |||||||||||||| | |||||||||||||||||||||||||||||||||||| ||||| ..ECTLWMTNF.PSYTQRNIRDLLQD.NVVALSIRLPSLRF.T.RRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVS.PLELE ----120-------130-------140-------150-------160-------170-------180-------190---------