Resonance Assignments for Yeast Prp24-RRM2
MTECTLWMTN FPPSYTQRNI RDLLQDINVV ALSIRLPSLR FNTSRRFAYI DVTSKEDARY CVEKLNGLKI EGYTLVTKVS NPLELEHHHH HH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.6 % (816 of 1108) | 77.0 % (443 of 575) | 65.8 % (287 of 436) | 88.7 % (86 of 97) |
Backbone | 77.8 % (423 of 544) | 86.3 % (157 of 182) | 67.9 % (186 of 274) | 90.9 % (80 of 88) |
Sidechain | 72.8 % (476 of 654) | 72.8 % (286 of 393) | 73.0 % (184 of 252) | 66.7 % (6 of 9) |
Aromatic | 9.2 % (9 of 98) | 10.2 % (5 of 49) | 8.3 % (4 of 48) | 0.0 % (0 of 1) |
Methyl | 90.9 % (100 of 110) | 89.1 % (49 of 55) | 92.7 % (51 of 55) |
1. Prp24-RRM2
MTECTLWMTN FPPSYTQRNI RDLLQDINVV ALSIRLPSLR FNTSRRFAYI DVTSKEDARY CVEKLNGLKI EGYTLVTKVS NPLELEHHHH HHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 uM | |
8 | TRIS | natural abundance | 10 mM | |
9 | potassium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | DSS | natural abundance | 10 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prp24-RRM2 | [U-99% 13C; U-99% 15N] | 500 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16246_2kh9.nef |
Input source #2: Coordindates | 2kh9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90--
-50--- AGAGAU |||||| AGAGAU ------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
B | B | 6 | 0 | 0 | 100.0 |
Content subtype: combined_16246_2kh9.nef
Assigned chemical shifts
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TECTLWMTNF.PSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLE ----120-------130-------140-------150-------160-------170-------180-------190-------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 575 | 426 | 74.1 |
13C chemical shifts | 436 | 256 | 58.7 |
15N chemical shifts | 104 | 83 | 79.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 182 | 153 | 84.1 |
13C chemical shifts | 184 | 82 | 44.6 |
15N chemical shifts | 88 | 77 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 393 | 273 | 69.5 |
13C chemical shifts | 252 | 174 | 69.0 |
15N chemical shifts | 16 | 6 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 48 | 84.2 |
13C chemical shifts | 57 | 49 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 1 | 2.0 |
13C chemical shifts | 48 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLE ----120-------130-------140-------150-------160-------170-------180-------190-------
-50--- AGAGAU |||||| AGAGAU
Dihedral angle restraints
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH ||||||| |||||||||||||||||||| |||||||| ||||||||||||||||||||| |||| ||||||||||| ....TLWMTNF.PSYTQRNIRDLLQDINVVAL.IRLPSLRF...RRFAYIDVTSKEDARYCVEKL..LKIE.YTLVTKVSNPL ----120-------130-------140-------150-------160-------170-------180-------190------
-50--- AGAGAU |||||| AGAGAU
RDC restraints
----120-------130-------140-------150-------160-------170-------180-------190-------200----- MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELEHHHHHH ||||||||| |||||||||||||| |||||||||||||| | |||||||||||||||||||||||||||||||||||| ||||| ..ECTLWMTNF.PSYTQRNIRDLLQD.NVVALSIRLPSLRF.T.RRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVS.PLELE ----120-------130-------140-------150-------160-------170-------180-------190---------